(data stored in ACNUC10043 zone)

EMBL: AP011532.PE180

AP011532.PE180       Location/Qualifiers
FT   CDS_pept        complement(173259..173603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60252"
FT                   /db_xref="GOA:D1YUY0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY0"
FT                   /protein_id="BAI60252.1"
FT                   /translation="MLMDVSSALISTGTMFVIGSVVLFLIYYFTSPLYTEYGDKRSRLY
FT                   YSLFNALYFSIVLAILFLILPSLSESSGMLISLAIGLVIILASTLVHVYAINVLVRRGI
FT                   IKIKQKRRIR"
     atgctgatgg atgtctcgtc cgccctgatc tccacgggca ccatgttcgt gatcggctcg        60
     gtagtgctct tcctcatcta ctattttacg tcccccttat acaccgagta cggggacaag       120
     agatcaagac tgtactacag cctcttcaac gcgctctact tttcgatcgt cctggccata       180
     ctcttcctca tccttccgtc gctgtcggaa agcagcggca tgctgattag cctggccatc       240
     gggctcgtca tcattctggc ctccacgcta gtccacgtgt acgccatcaa cgtcctggtc       300
     aggcggggca tcattaagat caagcaaaag aggaggatcc gctaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page