(data stored in ACNUC10043 zone)

EMBL: AP011532.PE186

AP011532.PE186       Location/Qualifiers
FT   CDS_pept        complement(180628..182109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60258"
FT                   /db_xref="GOA:D1YUY6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY6"
FT                   /protein_id="BAI60258.1"
FT                   /translation="MKAKSSALIVILLFLFISPALAQSSTDVPASAFQEKDLSISVAQS
FT                   NFSFDRSPSSQTLSIVVSNPTNSPMDVYLAVYQNQQWNVLEKLGSVAAGAQKTFDYPVN
FT                   FTYSGKSEEVDRFGVVGRTYAGYVGSVFSINENWTVYEDSLKSTLSIFGAASAAVLMLI
FT                   LIIVLAGVVSKALHTNYGNDGEYTLRTLFFPITKMRPWAERIANIIINPFFWVIEIALG
FT                   ALLVALILWFTLNETRPDIGWLVFLIGGVAAVFMPVIFLIIGWLADYYEREPFRFTVGM
FT                   FMWGVMATFFAFFINTTFSLVAGLILSAGAAQIILAVLVAPVVEETAKGTGLLILSGHH
FT                   DFDNVFDGIVFGFAIGMGFAFIENWLYFATNASPVAVGGLTEWTYNILYRSFLCSLAHG
FT                   CFTAATGAAIGFFKGRMKSAGFAIAGFFLGLPVAILLHGVFNLTAVFDSIMQTAFGVPL
FT                   PVFDPLLTIVITVIYIILGAYLQLKMKNNNKAVNR"
     atgaaggcaa agtcgtctgc tcttatcgtt attcttttat tccttttcat ttcgccggcc        60
     ctggcccagt cttccacgga cgtgccggcg tcggcattcc aggagaaaga cctgagcatc       120
     tcggtcgcgc agtcgaactt ctcgttcgac aggtccccct cgagccagac gctatccatc       180
     gtcgtgagca accccactaa ctcgcccatg gacgtatacc tggccgttta tcagaaccag       240
     cagtggaacg tgctggagaa gctggggagc gtcgcggccg gggcgcagaa gacgttcgac       300
     taccccgtta acttcaccta cagcggaaag agcgaggagg tcgaccggtt cggcgtggtg       360
     ggcaggacgt acgccggcta cgtgggttcg gtcttttcca ttaacgagaa ctggacggtg       420
     tacgaggact ccctgaaatc cacgctctcg atcttcgggg cggcttcggc ggccgtgctg       480
     atgctgatcc tgatcatcgt ccttgccggg gtcgtctcga aggcgctcca cacgaactac       540
     ggaaatgacg gcgagtacac gttacgtacg ctattcttcc ccatcacgaa gatgcggccc       600
     tgggccgagc gtatcgcgaa catcatcatc aacccgttct tctgggtcat cgagatcgcg       660
     ctcggggcgc tgctggtcgc cttgatactc tggttcaccc tgaacgagac ccgccccgac       720
     atcggctggc tggtgttcct catcggaggg gtggcggccg tgttcatgcc cgtcatattc       780
     ctgataatag gatggctggc cgactattat gagagagagc cgttccgctt caccgtgggc       840
     atgttcatgt ggggcgtgat ggccaccttc ttcgcgttct tcatcaatac cacgttctcg       900
     ctcgtggcgg gcctcatctt aagcgccggg gcggcccaga tcatcctcgc cgtcctcgtg       960
     gcgcccgtgg tggaggagac ggcgaagggc accggactat taatattatc gggccaccac      1020
     gacttcgaca acgtgttcga cggcatcgtg ttcggcttcg ccatcggcat gggcttcgcg      1080
     ttcatcgaga actggctcta cttcgccacg aacgccagcc ccgtggccgt cgggggcctg      1140
     accgagtgga cgtataacat tttataccgc tcgttcctgt gctcgctggc ccacggctgc      1200
     ttcacggcgg ccacgggcgc ggccatcggc ttcttcaagg gccgcatgaa gtccgcgggc      1260
     ttcgccatcg cggggttctt cctgggcctg ccggtcgcca tcctcctgca cggcgtgttc      1320
     aacctcacgg cggtcttcga ctccatcatg cagacggcct tcggcgtccc cctgccggta      1380
     ttcgacccct tgctgaccat cgtgataacc gtaatataca taatacttgg ggcatatcta      1440
     cagttaaaaa tgaagaacaa taataaggct gttaacaggt ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page