(data stored in ACNUC10043 zone)

EMBL: AP011532.PE188

AP011532.PE188       Location/Qualifiers
FT   CDS_pept        182719..183066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60260"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY8"
FT                   /protein_id="BAI60260.1"
FT                   /translation="MKIEREAYETATAAGMESEVPLLLVGDKGIITDILVVPCMDSADY
FT                   SMTRLRYITPMGMHVYGKVITKNDTKLGPGLNLIQEDGRWKFIDLDKNEVEVETVEGPP
FT                   RKEENIEESLP"
     atgaagatcg agcgcgaagc gtacgagacc gccacggccg ccggcatgga atccgaggtg        60
     ccgctgctgc tcgtcggaga caaggggatc attaccgaca tcctggtcgt cccgtgcatg       120
     gactcggccg actactcgat gacccggctc cgctacatca ctcccatggg catgcacgtg       180
     tacggcaagg tcatcacgaa gaacgatacc aaactcggtc ccgggctgaa cctcatccag       240
     gaagacgggc ggtggaagtt catcgacctc gataagaacg aggtggaggt cgagaccgtc       300
     gaagggcctc caagaaaaga ggagaatatc gaggagtcgc ttccctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page