(data stored in ACNUC10043 zone)

EMBL: AP011532.PE19

AP011532.PE19        Location/Qualifiers
FT   CDS_pept        complement(13386..13652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0147
FT                   family (IPR005354)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60091"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG9"
FT                   /protein_id="BAI60091.1"
FT                   /translation="MSNVEAVIKQCVDVLSRIKDDDTVPRNIRRSADSVKNILLNTKES
FT                   PAVRAASSISILDEISNDPNIPLHTRTLIWNIASQLETISVDG"
     atgtcaaacg ttgaagccgt catcaagcaa tgcgtggacg tgctgtccag gataaaggac        60
     gacgacacgg tgccccgcaa catcaggcga agcgcggata gcgtgaaaaa catactgctc       120
     aacacgaagg aaagccccgc agtgcgggcc gcgagcagca tatccatact ggacgagatc       180
     tcgaacgacc cgaacatccc gctccacacc cgcacgctca tctggaacat cgcgagccag       240
     ctcgagacca tttccgtgga cggatag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page