(data stored in ACNUC10043 zone)

EMBL: AP011532.PE2

AP011532.PE2         Location/Qualifiers
FT   CDS_pept        complement(1936..2277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Putative general stress protein B in
FT                   uncultured methanogenic archaeon (Q0W564)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60074"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="InterPro:IPR038956"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF2"
FT                   /protein_id="BAI60074.1"
FT                   /translation="MAEKEEKGDMTVEEAGRKGGEKTAKTHGKEFYQEIGHKGGEKTSE
FT                   THGKEFYQEIGHKGGEVGGHKGGEATARTHGKEFYQEIGHKGGEIGGKKGGQRVKELIE
FT                   EGKEAEEKK"
     atggcggaaa aagaggagaa aggcgatatg accgtcgagg aggcgggccg taagggcggg        60
     gagaagaccg cgaagaccca cggcaaggag ttctaccagg agatcggcca caagggcggg       120
     gagaagacgt ctgaaactca cgggaaggag ttctaccagg agataggcca caaaggcggg       180
     gaagttggcg gccacaaagg cggggaggcg accgcgagga cccacgggaa ggagttctac       240
     caggagatag gccacaaagg gggcgagatc ggcgggaaga agggcggcca gcgcgttaag       300
     gaattgatag aagagggtaa ggaagcggaa gagaaaaagt ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page