(data stored in ACNUC10043 zone)

EMBL: AP011532.PE204

AP011532.PE204       Location/Qualifiers
FT   CDS_pept        200308..201438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60276"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV04"
FT                   /protein_id="BAI60276.1"
FT                   /translation="MLPQRLTALAIISLFIMMLIPVALAQSSLTVEEYKYPNGTTVDAM
FT                   CVDSRGNVWLAQSSPATLYRVDPSAGTFDKYVIPTSSDTLFRGMSAEGSSYIWMADEGG
FT                   QQIIGYDVGKNKFYNFTFPLDLNPTDVIAQDNYLWVACNMELGRINMDTNEMKDYYVDR
FT                   YDASLADLAMDRMGNVWFVEYSSGKVGGYSRMDDQVHIFPIPTADSKPTCLGIDSQGRL
FT                   WFLESASSKLGMFDTNLNTFKEIDLPQLDGAQVYAKRLAVDSDDNVWLTDTANGRVIKY
FT                   YTAKDAFVPISLNGTKSYPTLIEADGNTIWAVESGASSLAKIRADPLYGLDATPTPTAT
FT                   PSPTPSATPTPKPTPGFEVIAALCAVCIVARKFNKN"
     atgctcccgc agagactgac ggcactcgcc attatatcct tattcataat gatgctcata        60
     cccgtggccc tggcccagag ctccctcacg gtcgaggagt acaagtaccc caacggcacg       120
     acggtggacg cgatgtgcgt ggacagccgg ggcaacgtgt ggctcgccca gagctcgccg       180
     gctacgctgt acagggtcga cccttccgcg ggcactttcg ataagtatgt gatacccacg       240
     agctccgaca ccctgttcag gggcatgagc gccgagggga gctcgtacat atggatggcc       300
     gacgagggcg ggcagcagat catcgggtac gacgtgggca agaacaagtt ctacaacttc       360
     actttccccc tggacctcaa cccgacggac gtcatcgcgc aggacaacta cctgtgggtg       420
     gcctgcaaca tggagctcgg ccggatcaac atggacacga acgagatgaa ggactactac       480
     gtcgacaggt acgacgcttc gctggcggac ctcgccatgg acagaatggg caacgtctgg       540
     ttcgtggaat actcgtcggg aaaggtcggc gggtactccc ggatggacga ccaggtgcac       600
     atattcccga tacccactgc cgactcgaag cccacgtgcc tcggcatcga ctcccagggc       660
     cggctctggt tccttgagag cgcgtccagc aagctcggca tgttcgacac gaaccttaac       720
     accttcaagg agattgacct cccgcagctc gacggggcgc aggtatacgc aaagcgcctg       780
     gccgtggact cggacgataa cgtctggctc acggatacgg ccaacggccg cgtcattaaa       840
     tattatacgg cgaaggacgc gttcgtgccc ataagcctga acggcacgaa gagctatccc       900
     acgctcatcg aggccgacgg caacacgata tgggccgtcg agagcggcgc ctcgtcgctg       960
     gcgaagatca gggccgaccc gctgtacggc ctggacgcga cccccacgcc cacggcgact      1020
     ccgtcgccga caccgagcgc caccccgacc ccgaagccaa cgcccgggtt cgaagtcatt      1080
     gctgcgctct gcgcggtatg cattgtggcg agaaaattta acaaaaatta g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page