(data stored in ACNUC10043 zone)

EMBL: AP011532.PE209

AP011532.PE209       Location/Qualifiers
FT   CDS_pept        complement(205117..205431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0209"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60281"
FT                   /db_xref="GOA:D1YV09"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV09"
FT                   /protein_id="BAI60281.1"
FT                   /translation="MGRVERRRFSREFKLQVLRELKGGKSVAEVCREYDLTRFLVARWK
FT                   REHEENPDAFQGKGKARVDENRTRELERLVGQLYAENDFLKRALANMKKREEDRGRDRI
FT                   "
     atgggaagag ttgagcggcg gaggttttcg cgggagttca agcttcaggt gttgcgggag        60
     cttaaaggcg gtaagagcgt ggcagaggtg tgcagggagt acgatctcac tcggtttctt       120
     gttgccaggt ggaagaggga gcatgaggag aatcctgacg cgtttcaggg taagggtaag       180
     gctcgcgtgg atgagaatcg tacgagggag ttggagaggc ttgtgggcca gttgtatgcg       240
     gagaacgatt ttttaaaaag agcgttggcc aacatgaaga aacgggagga agatcgaggg       300
     agggatcgta tatga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page