(data stored in ACNUC10043 zone)

EMBL: AP011532.PE221

AP011532.PE221       Location/Qualifiers
FT   CDS_pept        220174..220809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF115
FT                   family (IPR002826)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60293"
FT                   /db_xref="GOA:D1YV21"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV21"
FT                   /protein_id="BAI60293.1"
FT                   /translation="MRYEQWEPYYRAILQDFGWTAEGDEKAAELLSSMLPEDTPCLARV
FT                   EELIRGKEVIVCGKAPTLQKDMAKVDWWYKYTVIAADGAVSTLLDQGIVPDIVVSDLDG
FT                   RHEDLLEADSLGSIIVAHAHADNVEAVKSLVPKLRHVVGTTQARPLRNVYNFGGFSDGD
FT                   RCVFLAKELGAKSIKIIGFDLDDTKVTPKKLKKLKWARRLLGDLGINI"
     atgagatacg agcagtggga gccctattat agggccatct tacaggattt cgggtggacc        60
     gccgaggggg acgaaaaagc agctgagctg ctttcgtcca tgcttccgga ggatacgccc       120
     tgccttgcgc gcgttgaaga gctgatccgg ggaaaggagg tcatcgtctg cggcaaggcg       180
     cccacgctcc agaaggacat ggcaaaggtg gactggtggt acaagtacac cgtgatcgcc       240
     gcggacggcg ccgtctccac acttctagac cagggcatcg ttcccgacat cgtcgtgtcc       300
     gacctggacg gcaggcacga ggacctttta gaggccgatt cgctgggctc catcatcgta       360
     gcgcacgccc acgccgacaa cgtggaagcg gtcaagtccc tggtcccgaa gctgaggcac       420
     gtcgtgggca ccacccaggc gaggcccctg aggaacgttt acaacttcgg ggggttctcc       480
     gacggcgaca ggtgcgtctt tttagcgaag gagctcgggg cgaagagcat caaaataata       540
     ggcttcgacc tggacgatac taaggtcacg cctaaaaagc ttaaaaaatt gaagtgggcc       600
     cggcgcctgc tgggcgatct cggcattaat atttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page