(data stored in ACNUC10043 zone)

EMBL: AP011532.PE222

AP011532.PE222       Location/Qualifiers
FT   CDS_pept        complement(221322..221828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60294"
FT                   /db_xref="GOA:D1YV22"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV22"
FT                   /protein_id="BAI60294.1"
FT                   /translation="MRSRYIAALTAGIVGGVLLAGYLAVSFILELAAWNAWVPGAGTAS
FT                   NACGCLTLPAILIISLATGVLAAMRAKDLTKLSDAAIVSALAGALAGLIYGVVNVIIAF
FT                   LRPAIEFGMAVDSSDILGGIALGSIFGGAGGVMTCLCAPVGLILIAVVAAIGGAIYASV
FT                   KLNLK"
     atgcgatcca ggtacattgc tgccttaacc gccggcatcg tcggcggcgt acttcttgcc        60
     ggataccttg ccgtcagctt catactagag ctggccgcat ggaacgcctg ggtgccgggg       120
     gccggcacgg cgtcgaacgc ctgcggttgt ctgaccctgc ccgccatcct gatcatctcg       180
     ctcgccacgg gcgtgctggc ggccatgcgg gcgaaagacc tcacgaagct ctcggacgct       240
     gctatcgtct ccgccctcgc cggcgcgctg gccggcctca tatacggcgt cgtcaacgtg       300
     atcatcgcct tcctcaggcc cgccatcgag ttcggaatgg ctgtcgactc gtccgacatc       360
     ctgggtggca tcgcgctagg ttccatattc ggaggggcgg gcggtgtcat gacatgtctc       420
     tgcgccccgg tcgggctgat attaatagcc gtcgtggctg ccataggggg cgccatatat       480
     gcttcggtga agctgaatct aaaatag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page