(data stored in ACNUC10043 zone)

EMBL: AP011532.PE231

AP011532.PE231       Location/Qualifiers
FT   CDS_pept        228471..229256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF849,
FT                   prokaryotic family (IPR008567)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60303"
FT                   /db_xref="GOA:D1YV31"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV31"
FT                   /protein_id="BAI60303.1"
FT                   /translation="MVPTRKDSPYVPLTPEEIAEDTYRAYKLGVSSVHVHARDEAGNPT
FT                   YKKEVYGEIFSAIRRKCPDIIICASTSGRSDRSLEHRAEVLELRPDMASLMMGTVNFIK
FT                   NPSPNSQEDIVALAKRMEEHGVKPELEAFEPGFVNVAKYLASKGHLRPPLHFNLLLGSL
FT                   GSMPAEARDLVFLAGSVPPGSTWAATGIGRFQLQVNVASMLMGGHVRVGLEDSLYYSYP
FT                   EKSLATNEQLVERVARIARELGREIATPAEARAILGLDH"
     atggttccga cgcgcaagga ctcaccctat gttcccctca cccctgaaga gatcgccgaa        60
     gatacttaca gggcctataa gctgggcgtt tcttcggtcc acgtccacgc cagggacgag       120
     gccggtaacc cgacctataa gaaagaggtt tacggcgaga tattctcggc aatacggagg       180
     aagtgcccgg atatcatcat ctgcgcgtcc accagcggga ggtcagaccg tagcctggag       240
     cacagggccg aagtcctgga gctgaggccg gatatggcgt ccctgatgat gggcacggtg       300
     aacttcataa agaacccaag cccgaactcc caggaggaca tcgtcgccct ggcgaagagg       360
     atggaagagc atggcgtgaa gccggagctg gaggcttttg aaccgggttt cgttaacgtg       420
     gcgaagtacc tggcatcaaa gggccacctg cgcccgccat tacactttaa ccttttactg       480
     ggctcgctgg gcagcatgcc cgctgaggcc cgggacctcg tctttctcgc cgggtcggtg       540
     ccgccgggca gcacctgggc ggctactggc ataggcaggt tccagctcca ggtgaacgtg       600
     gcgtcgatgc tcatgggagg ccacgtcagg gtaggcctgg aggactcgct ttattattct       660
     tatcctgaaa agtcgctggc cacgaacgag cagctcgtgg agcgggtagc ccgcatcgcc       720
     cgtgagctgg gcagggagat cgccactccg gcggaggcca gggcgatcct gggccttgat       780
     cattga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page