(data stored in ACNUC10043 zone)

EMBL: AP011532.PE235

AP011532.PE235       Location/Qualifiers
FT   CDS_pept        235704..236831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60307"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV35"
FT                   /protein_id="BAI60307.1"
FT                   /translation="MDASRTDIVCFSDIFWDFVWQRHQSLLTRFPEGWNILFVEPTSLV
FT                   VLLKEPRRLLARKHGNITVISSPALPLTDKVSILRPVNDIFIWCWLKAMFLKHNITRPV
FT                   LLYYAPRFSSLIGRLGERLATYDCADDRMAFSREPHWMGPYVENLFKKSGIVFVTSESL
FT                   RKKALGYRSDNVHLIGNGVDAGLFEKAWGDVPVPDDIKWLKKPIIGYFGVIDEWMDIDL
FT                   IVRMASAYPEASIVLVGPALIGPEGLQKLKSLPNVYLPGQKPHDALPGYLKAFDVCIIP
FT                   FRINELTKSVNPVKLYEYLAGGKNVVTITMAEVEKYDGTIYIARDHDDFIRKTADALRN
FT                   KPDADRMKAVVSENTWDSKAKAMVEIIQRSIDTHG"
     gtggacgcga gcaggaccga catcgtatgc ttttctgata tcttctggga tttcgtctgg        60
     cagaggcacc agagcctgct gacgcgcttc cctgaaggct ggaacatact cttcgtcgag       120
     cccacgtcgc tagtggtcct gctcaaggag ccccgccggc tcctcgcccg gaaacacggc       180
     aacattaccg tcatttcttc gccggcgctg ccgttgaccg ataaggtctc gatcctgcgg       240
     cccgtgaacg atattttcat atggtgctgg ctcaaggcga tgttccttaa acataatatc       300
     acgcgcccgg tgctgctgta ctatgccccg aggttctcgt cgctcatcgg gcggctcggg       360
     gaaaggctgg ccacctacga ctgcgcggac gacaggatgg cattctctcg tgaacctcac       420
     tggatggggc cgtacgtgga aaacttgttt aaaaagtcgg gcatcgtgtt cgtcacctcg       480
     gagagcctca ggaaaaaagc tcttgggtac aggagcgata atgttcatct cattggcaac       540
     ggcgtggatg ccggcctgtt cgaaaaagcc tggggtgatg tgcccgtgcc tgacgacatc       600
     aagtggctaa aaaagccgat catagggtat tttggggtca tcgacgagtg gatggacatc       660
     gacctcatcg taaggatggc ctcggcatat cctgaagctt ctatagtcct ggtcggcccg       720
     gcgctcattg gcccggaggg gctgcaaaaa ttaaagagcc tcccgaacgt ctatttaccc       780
     ggccagaagc cccacgatgc gctgcccggg tacctgaagg cgttcgatgt ctgtatcatc       840
     cccttcagga ttaacgagct cacgaagagc gtcaatccag tcaagctata cgagtacctt       900
     gcgggcggca agaacgtcgt aactattact atggccgagg tggagaagta cgatgggacc       960
     atatacatcg cacgcgacca cgatgatttc ataaggaaga cggcggatgc gctccggaat      1020
     aagccggacg ccgacaggat gaaagctgtg gttagcgaga acacctggga tagtaaggca      1080
     aaggccatgg tcgaaataat ccagaggtcg atcgatacgc atggatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page