(data stored in ACNUC10043 zone)

EMBL: AP011532.PE237

AP011532.PE237       Location/Qualifiers
FT   CDS_pept        complement(238247..238903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0237"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Methyltransferase type 12 domain
FT                   (IPR013217)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60309"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV37"
FT                   /protein_id="BAI60309.1"
FT                   /translation="MGSIVHLLSMELFGESIPLSEFPVRKDITGIGMSDWDVYTSRLAK
FT                   KLGYTNTFYHKEPKLDIISVDDIQNGKYDFIISSDVFEHVVPPVSTAFYNTGKLLKRGG
FT                   VLIFSVPYISTPGHGTVEHFPDLYQYKIINMRQGKILKNITAEGVSQTYTNLTFHGGKG
FT                   NTLEMRSFSESSLWDELRKAGFKDIKKYNQSYKEYGIVWTDEHITHCSPPLTARI"
     atggggtcga tcgtacatct attatccatg gaactatttg gcgagagcat accgctctct        60
     gaattcccgg tccgaaagga cattacaggc ataggcatga gcgactggga cgtgtatacg       120
     tcgcgcctgg caaaaaaatt aggatatacg aacacatttt accataaaga gccaaaactg       180
     gacatcatat cggtagatga tatacagaat ggcaaatatg actttatcat ttcctcggat       240
     gtattcgagc acgtagttcc tcccgtatca acggctttct acaacactgg aaaattatta       300
     aaaaggggcg gagtgctgat attttcagtc ccgtatattt ctacgccagg ccacggtacc       360
     gtcgagcatt ttccggattt gtatcagtat aagataatta atatgagaca ggggaaaatt       420
     ttaaaaaata taactgcgga aggggtcagt cagacttata cgaatttaac atttcacgga       480
     gggaagggca acacgctcga aatgagatcg ttctcggagt cgtcgttatg ggatgaactc       540
     cgaaaagccg gctttaaaga tatcaaaaaa tacaaccaat catacaaaga atatggtata       600
     gtctggaccg atgaacatat aacgcattgc tctccaccgc taactgcaag gatttga          657
//

If you have problems or comments...

PBIL Back to PBIL home page