(data stored in ACNUC10043 zone)

EMBL: AP011532.PE242

AP011532.PE242       Location/Qualifiers
FT   CDS_pept        complement(242157..244133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60314"
FT                   /db_xref="GOA:D1YV42"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV42"
FT                   /protein_id="BAI60314.1"
FT                   /translation="MIIDYSIFFLSYVCWFIALVGFGSVSVDFIKKTFHIDSDGEHLSL
FT                   LTYGIAGMAVVTTLATLINFFMPISLTVTIVLLFFGIGLFFFNRKSILTYLSWFEKVLI
FT                   STLALLIFMIIPFAWVSWFDTGMYHLPAIKWIIESQAPLGLANLHGRFGYNCSWFMLSA
FT                   CIDQWVIILNKPFFLVNGLIMFFYASAILLIVKRKIFPARLDKAGDISRHKGAKDKNIE
FT                   IGLSDLFLIFSSIALVYPGLMMLTSSSPDLPVMIITLFVIYLAIYVLERTQNDNFYLFF
FT                   AILLVAYAITIKLSSIALIVSLPVFLFQGTIESFKNKGKILDIFNDGMKEILNVLLLAI
FT                   LLLLTLPWMIRGLLLSGCLFFPFRIVYFSGLKWAVPPLLCTSEINWTTAWARLPSNDAL
FT                   TALSGWGWVKPWLERYFNIFGWSHMPLSRQIIIGTELDDFIYSLTQNIIISFIYPIAEL
FT                   VVPFIIFISGLLLIFYYIVFKKERLSNISLNKTACIIPMAISIIGIAFWFYSAPDLRFG
FT                   IGFVYSLVLLTFSIPVYIYLFSKPRGQQLQTNVVQKRMKIIVIVLSAIILIYGSCIAIY
FT                   YSTNTHGWGSDGFNFPQIQLDGYKTVDGTTIYISSGQYQLFWNGPLPNTPYFNASLRSH
FT                   ISNSTGLPDMFWYDDKNGLPIIL"
     gtgataatcg attatagtat tttttttcta tcgtacgtct gctggttcat agcgttagtt        60
     ggtttcggta gcgtatccgt tgattttatt aaaaagacct ttcatatcga ttctgatgga       120
     gagcaccttt cactgctgac ctatgggatt gcaggtatgg cagtagttac tacacttgcc       180
     actttaatta atttttttat gccgataagc ctcaccgtaa cgattgtact attatttttt       240
     ggaataggtt tattcttctt taacagaaag tcgatcctta cgtatttaag ctggtttgaa       300
     aaggtcctga tatcaacact cgccctgcta atctttatga taatcccgtt tgcctgggtt       360
     tcttggttcg acacgggcat gtatcattta ccagcgatta aatggatcat cgagagtcag       420
     gcgcctcttg ggcttgcgaa cttgcacggg cgttttggct ataactgctc atggttcatg       480
     ctttcggcct gcattgacca atgggtaatt atcctgaata agccgttttt cctggtgaac       540
     gggttgatta tgttctttta tgcatccgca atattactta tcgttaaaag aaaaattttt       600
     cccgcccgcc tggacaaggc gggcgacatt tcaaggcata agggcgccaa agacaaaaat       660
     attgaaattg gcttaagtga cctgttctta atattctcat cgatcgccct ggtctacccg       720
     ggacttatga tgctgacgtc gtcatccccg gatttacccg tcatgataat aacattattt       780
     gttatttatc tggccattta tgtgctggag cggacacaaa atgataattt ttacttgttc       840
     tttgccatac tcctcgtggc atatgccatt accattaagc tgtcctcaat tgcgcttatc       900
     gtctcgttgc ctgttttctt gtttcagggt acaattgaat catttaaaaa taaaggtaaa       960
     atccttgaca tattcaacga tggaatgaag gaaatactca atgttctttt attggctata      1020
     ttactattat taaccttacc atggatgata cgagggctat tattatcagg ctgtctattc      1080
     ttcccatttc ggatcgtgta cttttccgga ttaaaatggg ctgtaccgcc gcttctatgc      1140
     acaagcgaaa taaactggac tacagcatgg gctcgattac caagtaatga tgcccttact      1200
     gctctgtcag gatggggatg ggtcaagccc tggcttgaaa gatattttaa tatcttcggc      1260
     tggagccaca tgccgctctc aagacagatc ataatcggaa cagagctgga tgattttatt      1320
     tattccttga cccaaaacat cattatctcg tttatttatc cgatcgcaga attagtagtc      1380
     ccgtttatca tatttatcag tgggctcttg ctgatcttct actatattgt ttttaaaaag      1440
     gaaaggctct cgaacatatc actaaataaa actgcatgta ttatccccat ggccatttcc      1500
     atcatcggta tcgcgttctg gttctattcg gccccagact tacgattcgg catcgggttc      1560
     gtttattcgc tggtacttct cacattcagt ataccggtat acatatattt attcagtaag      1620
     ccaagaggac agcaattgca aacgaatgtt gtgcaaaaaa gaatgaaaat tattgtgata      1680
     gtactctcgg ccattatatt aatatacggt agctgtattg ctatatatta ttcaacgaat      1740
     acacatggat ggggttcgga cggatttaac ttcccccaga ttcagcttga tggttataaa      1800
     accgtcgatg gcacgacaat atatatttca agtggccagt atcagctttt ttggaatggt      1860
     cctttgccaa atactcccta tttcaatgct agtttgagat ctcatatctc gaattctact      1920
     ggattgccgg atatgttctg gtatgatgat aaaaacgggt taccgatcat actgtga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page