(data stored in ACNUC10043 zone)

EMBL: AP011532.PE249

AP011532.PE249       Location/Qualifiers
FT   CDS_pept        complement(251875..252543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60321"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV49"
FT                   /protein_id="BAI60321.1"
FT                   /translation="MGVLDMLMGKRKESGPADIAGLFDQSIKDVEDPRTIGESPALNKA
FT                   IMEYQSPENVDKGQIFTFDSEIKRAPDFYLPYYWAATYHFDKGNFDEAKKILLEGIKNC
FT                   RIKSVLCRRLGEFCLQNGDVDGALYWFFTTVMADTSSIDYHAYLYLAYIFEVYGMKKAE
FT                   SWSLRRARGISYKILMQAAEYSAKKKEKIKGFAGAHKSEAIAKKLDDFYRYAKPALKAL
FT                   "
     gtgggcgtac tagacatgtt aatgggaaag cggaaagaat ccggcccggc ggacatcgcg        60
     ggccttttcg atcaaagcat taaggacgtg gaggacccca ggacgatcgg cgagagccct       120
     gccctgaaca aggccatcat ggaataccag agcccggaaa acgtcgataa gggccagatc       180
     ttcacgttcg acagcgagat aaagagggcg cccgacttct atctgcccta ctactgggcg       240
     gccacgtacc acttcgataa gggcaacttc gacgaggcga agaagatcct tctcgagggc       300
     attaaaaatt gccgcatcaa gagcgtgctg tgcaggcggc tcggcgagtt ctgcctgcag       360
     aatggcgacg tcgatggcgc gctctactgg ttttttacca cggtcatggc ggacacgagc       420
     agcatcgact accacgcgta cctctacctg gcctatatct tcgaggtcta cggcatgaag       480
     aaggcggaga gctggtccct gcgcagagcc cgcgggatct cctataagat attgatgcag       540
     gctgccgagt actcggccaa gaaaaaggag aagatcaagg gcttcgccgg ggcccataag       600
     agcgaggcca tcgcgaagaa gctcgacgac ttttaccggt acgcgaagcc cgcgctgaag       660
     gcgctctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page