(data stored in ACNUC10043 zone)

EMBL: AP011532.PE25

AP011532.PE25        Location/Qualifiers
FT   CDS_pept        17105..18079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60097"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH5"
FT                   /protein_id="BAI60097.1"
FT                   /translation="MQATLDWLAGLARQHPEVFGGHPGEMAVLEASRSSSHESRVYGSG
FT                   GALVHVKFFRRTLGRTSVTYDPCREMKAEYDTLREFEKNGFASGRHRVVRTLGINESLD
FT                   CALATAYVPGDTLLSIIQRTLKGGDDGELLEALGLAAGFLRKVHGLMPQSPKVDAAETF
FT                   YSYMKPLFYLEEQGALDGFHRRVTKGLSRWYGHRPLFEQRGVTVHGDANPSNFKIHEGV
FT                   IYGLDLERSRPGRSPLLDVGTMVAELEHHCAYVAGDAGRAKPYVERFLRAYAPSPADRK
FT                   KIDELLPFYVSRGLLKIAMLGYWKHGYRRSLVEAGARRIEEGP"
     atgcaggcca cgctcgactg gctggccggc ctggccaggc agcaccccga ggtgttcggc        60
     ggccatcccg gcgagatggc cgtgctggag gcctccaggt catcgtccca cgagtcccgc       120
     gtatacgggt cgggcggcgc cctggtccac gtgaagttct tccgccgcac cctggggcgc       180
     accagcgtca cctacgaccc ctgccgggag atgaaggccg agtacgacac gctcagggag       240
     ttcgagaaga acgggttcgc atcgggccgc caccgggtcg tgcgcacgct cggcataaat       300
     gaaagcctgg actgcgccct ggccacggcc tatgtgcccg gggacacatt gctttcgatc       360
     atacagcgga cgctgaaggg cggcgacgac ggcgagcttc ttgaagccct cggcctggcg       420
     gccggcttcc tgaggaaggt ccacggcctg atgccccaga gcccgaaggt cgacgccgcg       480
     gagacgttct actcgtacat gaagccttta ttctatctgg aggagcaggg cgcgctggac       540
     gggttccaca ggagagtgac gaaggggctg agccgctggt atggccacag gcccctattc       600
     gagcagaggg gggtgaccgt ccacggcgat gccaacccct cgaacttcaa aatacacgag       660
     ggggtcatct acggcttaga cctggagcgc agccgcccgg gccggagccc cctccttgac       720
     gtgggcacca tggtggccga gcttgagcac cactgcgcct acgtggccgg cgacgcgggc       780
     agggcgaagc cttacgtcga gcgctttctg cgggcatacg ctccctcccc ggcggaccgg       840
     aaaaagatcg acgagctcct gcccttctac gtgtcccggg gcctgctcaa gatcgccatg       900
     ctgggatact ggaagcacgg ctaccgccgc tcgctcgtcg aggcgggcgc caggcgcatc       960
     gaggaggggc catga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page