(data stored in ACNUC10043 zone)

EMBL: AP011532.PE252

AP011532.PE252       Location/Qualifiers
FT   CDS_pept        255436..256098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60324"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV52"
FT                   /protein_id="BAI60324.1"
FT                   /translation="MSQTLQFEIDPLRISGDFVGSVLVAVDVMAYSREDYPRPDAPVCL
FT                   IAAAHTGGLSSISKAYTKLFIAGAPTLPEEKLIIRDFAAYLDMFDGGTLAAHYGALDSP
FT                   DEGFDVPYLLARAKSQHPEVYVSLRRPLNKLKRHDTCAYVKENMNLPSAELDYVESYYG
FT                   LARKPDAIIPDVKAAMDSYWRSGDASALKSGLANAYNCLRIAQSQIKKTICCTDIPL"
     atgagccaga ccctccagtt cgagatcgac cctcttcgca tttcgggaga cttcgtgggc        60
     agcgtgctcg ttgccgtcga cgtcatggcg tactcgaggg aggactaccc caggcccgac       120
     gcgcccgtat gcctcatcgc ggcggcccac acgggcggcc tgagctcgat cagcaaggcc       180
     tacacgaagc tgttcatcgc gggcgccccg acgctgccgg aggagaagct catcataagg       240
     gactttgcgg cctacctgga catgttcgac ggggggacgc tggccgccca ctacggggca       300
     ttagattcgc cggatgaggg cttcgacgtg ccctacctcc tggccagggc gaagagccag       360
     cacccggagg tctacgtatc cctcaggcgg ccgctgaata aattaaaacg ccacgacacc       420
     tgcgcctacg tcaaggagaa catgaacctg ccctccgcgg agctcgacta cgtggagagc       480
     tattacgggc tggcccggaa gccggacgcc atcatcccgg atgttaaggc agcgatggat       540
     agctactgga ggtcggggga cgcctcagcg ctcaagagcg gcctcgcgaa cgcctataat       600
     tgtttgcgga tcgcgcagtc gcagatcaaa aaaacaattt gctgcacgga cattccgcta       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page