(data stored in ACNUC10043 zone)

EMBL: AP011532.PE259

AP011532.PE259       Location/Qualifiers
FT   CDS_pept        264347..265435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0259"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60331"
FT                   /db_xref="GOA:D1YV59"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV59"
FT                   /protein_id="BAI60331.1"
FT                   /translation="MTLEEEIRAIQEEMDKTQKNKATEHHMGRLKAKMARLKDELIKKA
FT                   IASRGGGAEGYSVKKSGDATVTLVGFPSVGKSTLINKLTDAHSEVGSYDFTTLDVIPGI
FT                   MEYKQARIQVLDLPGLVKGASSGRGRGREVISVIRGCDLIVLIIDVFNYQHMKVLEDEL
FT                   YDAGIRINQRPPDVTITKLVKGGITITSTVELSIDHETIKTVLGEYRMHNALVNIREDI
FT                   TADQLIDVVRGNRVYIPCITVVNKIDLVDKEHMKSFPKDALKISADMESGLDALRDEIY
FT                   DSLGFINIYLKPQGEPADMDEPLIMRAGCTVGDVCDRLHKDFRRKFRYARVWGDSAKHA
FT                   GQRVGVDHGLEDGDVLTVIIQK"
     atgacactcg aagaagaaat acgggccatc caggaagaga tggacaagac ccagaaaaat        60
     aaggccaccg agcaccacat gggcaggctt aaggctaaga tggcccgcct caaggatgag       120
     ctcattaaaa aggccatcgc gtccagaggt ggcggcgcgg aaggctatag cgtcaagaag       180
     agtggggacg ctaccgtcac tttagtcgga ttcccatcgg tgggaaagtc cacgctcatt       240
     aacaaattaa cggatgcaca ctctgaagtc ggatcatatg attttacaac gttagatgtc       300
     atcccgggta tcatggagta caagcaggcc aggatacagg tgctcgacct gcccggcctg       360
     gtcaaaggcg cttcatccgg ccgcggcaga ggccgggagg tcatctcggt catccggggc       420
     tgtgatctga tcgtattgat catcgacgtg ttcaattacc agcacatgaa agttctggaa       480
     gatgagctct acgacgccgg catccgcatc aaccagcggc cgcctgatgt gaccatcacg       540
     aagctcgtaa agggcggcat aaccatcacg tccaccgtcg agctgagcat cgaccatgag       600
     accatcaaga cagttctggg cgagtacagg atgcataatg cgctcgtgaa catccgtgag       660
     gacatcaccg cggaccagct catcgacgtc gtccggggca atcgagtcta tataccgtgc       720
     atcaccgtcg tcaacaagat agacctcgtg gataaagagc atatgaaatc gttcccgaag       780
     gatgccctga aaatctcggc cgacatggag tccggcctgg acgcgctgcg cgacgagatc       840
     tacgacagcc tcggtttcat caatatatac ctgaagccgc agggcgagcc cgcggacatg       900
     gacgagcccc tcatcatgag agcggggtgc acagtgggcg acgtatgcga ccggctccac       960
     aaggacttcc ggcggaagtt ccggtacgcc cgggtctggg gcgactcggc caagcacgcc      1020
     gggcagcgcg tgggggtcga ccacggtctc gaggacgggg acgtgctgac ggtcatcata      1080
     caaaaatag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page