(data stored in ACNUC10043 zone)

EMBL: AP011532.PE260

AP011532.PE260       Location/Qualifiers
FT   CDS_pept        265611..266132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60332"
FT                   /db_xref="GOA:D1YV60"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV60"
FT                   /protein_id="BAI60332.1"
FT                   /translation="MRFNKDNYAQMSIDFLIGITIFILAFLFVMMSIPQMFTPFQSNSD
FT                   ELTMIADRVASTLVENTLAYRVVETDTILTSIIDIDKFDNTYKTDPPTLLYSEVGLDNQ
FT                   KYCIEIDIEQLKVDNTIHVTDSIIDTTHPLGNQNVGQSRRFVIIRSPDENNGWTDTKAV
FT                   IVVRIWQWAY"
     atgcggttta ataaggacaa ttatgcacaa atgagcattg actttcttat agggatcact        60
     atattcatat tagcattctt gttcgtgatg atgtccatac cacaaatgtt tacgccgttc       120
     cagtccaact cagatgagct aaccatgatt gcagacaggg tagcttcgac gctagtcgag       180
     aacacgctgg cttatagagt agttgagact gatacaatat taacaagtat catagacatt       240
     gataaattcg ataatactta taaaacggac cctcctactt tactttatag cgaagtaggg       300
     cttgataatc aaaagtattg tatagagatt gatattgagc aattaaaagt tgataataca       360
     attcatgtta ctgattcaat aattgataca acacatcctt taggtaatca gaatgttggt       420
     caaagccgtc gatttgttat aattcgcagc cctgatgaaa ataatggatg gacagacacg       480
     aaggctgtaa ttgtggtgag aatatggcaa tgggcgtact ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page