(data stored in ACNUC10043 zone)

EMBL: AP011532.PE261

AP011532.PE261       Location/Qualifiers
FT   CDS_pept        266120..266734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60333"
FT                   /db_xref="GOA:D1YV61"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV61"
FT                   /protein_id="BAI60333.1"
FT                   /translation="MGVLGDNGQISTVEAITAAIIMISVIVLVVQATSVTPLTSSFTNQ
FT                   HIKLELQNIGMDVLTTLDETPSVNDGNHDTQSMLKKSVTDWINNYYCDWFTWANNADKY
FT                   KSQTNPLNPSLNIPLGDQLSYLLAYYGIAYNVEIRYSDINNNVKITKMIWNGNPSDNSV
FT                   TVSRFVVLHDEDILYRDLIPNFGLTTDFYNIVEVKVTLWVM"
     atgggcgtac taggtgacaa tggtcagatt tctacagtag aagctataac agcagctata        60
     atcatgattt ctgtaattgt tcttgtagta caggcaactt ctgtaactcc tctcacgtca       120
     tctttcacta accagcatat caagttagaa ttacaaaata taggcatgga tgtacttact       180
     actcttgatg aaacgccttc ggtgaacgat gggaaccatg acacccagtc aatgttgaaa       240
     aaaagtgtaa cggattggat taataattat tattgtgatt ggtttacatg ggctaataat       300
     gctgataaat ataaaagtca gaccaatcca ttgaatccta gtcttaatat tccactagga       360
     gaccaattaa gctacctgtt ggcatactat ggtatagctt acaatgttga aattcgatat       420
     tctgatatta ataacaatgt taagattaca aagatgattt ggaatgggaa cccatctgat       480
     aactcagtaa cggtttcccg ttttgtggta ttacacgatg aagatatctt gtatagagat       540
     ctgataccaa attttggcct aactacagat ttttacaata tcgtcgaagt gaaagtcaca       600
     ttatgggtga tgtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page