(data stored in ACNUC10043 zone)

EMBL: AP011532.PE264

AP011532.PE264       Location/Qualifiers
FT   CDS_pept        268522..269316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60336"
FT                   /db_xref="GOA:D1YV64"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV64"
FT                   /protein_id="BAI60336.1"
FT                   /translation="MREIIYSDEAVSESLGFVLIACIITFAISLVIMLGYPVYVNSINE
FT                   AHMQNMEEGFYLLSTNGNMVAMYQSPAQSSELKLDNGALYTRIDGEISVICKDSANNVI
FT                   NPFDTPYPLTSLEYQLGNMRIAYDLGGVFKKDGSSSIVLKEPPIYYKTALVVPVITIQN
FT                   SIGSISGKGLTRITLNSPYSSKISSTVSYQNAKIYTHVKSVQINIKCDYNDALQRYFKD
FT                   SQGSLQFDSAIIDSNGVLIATKTYPTDITVYITPSYVNVKVN"
     atgagagaga tcatatactc agatgaggct gtatccgagt ctcttggatt tgtgttgatt        60
     gcgtgcataa ttacgttcgc aatatcactc gtaataatgc taggataccc tgtatatgtg       120
     aatagtatta acgaagctca tatgcaaaat atggaagagg gcttctacct gttatcgaca       180
     aatggtaata tggtcgctat gtaccaatcg cctgcacagt cgagcgagtt gaagctagat       240
     aacggtgcac tatacacgcg tattgatggt gaaattagcg taatctgcaa agattctgca       300
     aataatgtta tcaacccttt tgacaccccc tatccattga catcgcttga atatcaactg       360
     ggtaatatga gaatagctta tgatttaggt ggtgtattta aaaaggatgg tagctcatcg       420
     atagtattga aagagccccc aatatactat aaaacagcct tagtggtgcc cgtaattaca       480
     atacagaatt ctatagggtc aattagtggt aaaggcctta caaggatcac tcttaactcg       540
     ccttacagct caaaaatatc tagtactgtt agctatcaaa atgcaaaaat atacacacat       600
     gtaaaatcag tgcaaattaa tattaagtgc gattacaacg atgcattaca gcgttatttt       660
     aaggattccc aagggtcgct tcagtttgat agcgcaatta ttgattcgaa tggcgtactt       720
     atagctacga aaacataccc tacagatata accgtatata taacacccag ctatgtcaac       780
     gttaaagtga attga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page