(data stored in ACNUC10043 zone)

EMBL: AP011532.PE265

AP011532.PE265       Location/Qualifiers
FT   CDS_pept        269326..270852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60337"
FT                   /db_xref="GOA:D1YV65"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV65"
FT                   /protein_id="BAI60337.1"
FT                   /translation="MTDNVIGSGNMRIFDSEEAVSEVFGYIIILGILIAALGVILIYES
FT                   PSIQDTKDSGQMSQNEQAFTVLDSRLSKARFSTSIFQEVPFKVTDGTVKVDDTSSKITV
FT                   TDIEEDLSGNIISTTQLYSENLGTLKSIGKDVEIGYEDGGVWELYPNGGGSIMISPPDF
FT                   NYNGITLTLPVTLIRSDNTLNGYSSAGYSNSIAVIDAESTGISTIKYPNADKGWANPIA
FT                   TGHYIEVKITSDYANAWKSYFNERVEGAEATIDPGNPRTVIIRLSSGWPLQTGLYSDGF
FT                   TTSYMETTDTNIPLDEFMFDLFTVNPGNDFWLTYGVKPQGVTTPDPQLLIYMCRHLGNQ
FT                   NKDLADIRIQYQKGSQIEIFEGTVPFHRKVDNEIYIDMLSHDETLTYRADSSPKAITWG
FT                   SDPSNPDPGIAAGLDNGAEVSIGDTRTLYDVSQHYMWLMAYEDQNNGNLYNGPQYVVYS
FT                   THDYSPGNPHPNKKDLEDSKFTLKYKSKQDIKYLYITEGTLKISLGGKSA"
     atgacggata atgtcatcgg aagcggtaat atgagaatat ttgacagtga agaagcagta        60
     tcggaagtat tcgggtacat cataatcctc ggaatattaa tagcagcgct aggcgtaata       120
     ttaatttatg aatcgccttc gatacaggac acaaaggaca gtggccagat gagccagaat       180
     gagcaggcat ttaccgtact tgattctcgg ctgagtaagg cccggtttag cacgtcgata       240
     ttccaggaag tcccgttcaa ggtgacagat ggcacagtaa aagtggatga cactagtagc       300
     aagattaccg tgactgatat tgaagaagat ttatcaggta atattatctc tacaactcaa       360
     ctctacagcg agaacctagg cacattgaaa tccataggta aagatgtcga gattggctac       420
     gaggatggtg gtgtatggga gctatatcca aatggaggtg gctctatcat gatatccccc       480
     ccagatttta attataatgg tattacgctt acgcttccag ttactctcat aagatctgat       540
     aacactctga atggttatag cagtgcaggg tatagtaata gcattgctgt gattgatgca       600
     gaatccaccg gcatatcgac gattaaatac cctaatgctg acaaaggctg ggcaaatcct       660
     atagcgacag gccattatat agaggtcaag attacttctg attatgctaa cgcatggaaa       720
     tcttatttta acgaacgtgt agagggtgct gaagctacta tagatcctgg taatccgagg       780
     actgtgataa ttaggctttc tagtggatgg cctctgcaaa ccggtttgta tagcgatggg       840
     tttactacgt catatatgga gacgacagat acaaatatac cactagatga gttcatgttc       900
     gatttattta ctgtcaatcc aggtaacgac ttctggctta cctatggcgt aaaaccgcag       960
     ggcgttacga cacctgatcc acagctatta atttatatgt gtcgacatct tggaaaccaa      1020
     aacaaggatt tagctgatat ccgaatacaa taccaaaagg gttcccagat tgaaatattc      1080
     gagggtacag taccatttca taggaaagtc gataatgaaa tttatatcga tatgttaagt      1140
     catgatgaaa cattgacata tcgggctgat tcttccccga aagctattac ttggggctcg      1200
     gacccgagta atcctgaccc aggtatagca gctggtcttg ataatggtgc ggaagtatct      1260
     ataggagaca cgaggacttt atatgatgta tcacagcatt atatgtggct tatggcatat      1320
     gaagatcaga acaacggcaa tttgtataat ggcccacaat atgtcgtata tagtactcac      1380
     gactattccc ctggtaaccc gcacccaaat aagaaggatt tagaggattc taaatttaca      1440
     ctgaaatata agtcaaagca agatataaaa tatctttata ttactgaagg tacgctaaaa      1500
     atatcgttag gtggaaaatc agcataa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page