(data stored in ACNUC10043 zone)

EMBL: AP011532.PE266

AP011532.PE266       Location/Qualifiers
FT   CDS_pept        270981..271970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60338"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV66"
FT                   /protein_id="BAI60338.1"
FT                   /translation="MIIMKLNPTQVKEKYGPMFSQRFLTMVDSSRNVAEIIETCAVKGT
FT                   IEWDAVNRCRAGGAIQWCEVEGTTMVMRARLGESPIKFGPTDVEYGGQGLEAVLVDGDK
FT                   VITKWAGCGGAGLGVAACLTQAPGVLHAIYPTEEDMKVGGARANRVELVTPLYEKVTIG
FT                   IDDTDNKEGGATWVLALKASKMAAAIDGVQSLNLRLIQLFPKSPHKTTNCVSSAITFAA
FT                   RPDAVDSLIKSVVATVKRETRSSKTGIAVYRGIGISPALNAFGWEVKKHLVTVETVEEN
FT                   AKGTGIEFIDLFPNREGRIGALAAVALSEERTDAAALYNDCALPLIRR"
     gtgatcatca tgaagctcaa cccaacgcag gtgaaagaaa agtacggccc gatgttctcg        60
     cagcgcttcc tgaccatggt ggacagctcg aggaacgtcg ccgagatcat cgagacgtgc       120
     gccgtgaagg gcaccatcga gtgggacgcc gtgaaccgtt gcagggccgg cggtgccatc       180
     cagtggtgtg aggtcgaggg cacgaccatg gtcatgaggg cccggctggg cgaaagcccg       240
     atcaagttcg gccccacgga tgtagagtac ggcggccagg gcctcgaagc cgtcctagtg       300
     gatggcgata aagttatcac caaatgggcc ggctgcggcg gtgccgggct gggcgttgcc       360
     gcgtgcctca cgcaggcgcc tggtgtgctt cacgccatct atcctacaga ggaggacatg       420
     aaggtcggcg gcgccagggc gaaccgcgtg gagctcgtca ctccgctcta cgagaaggtc       480
     accatcggca tcgacgatac ggataacaag gagggcggcg ccacctgggt gctggcgctc       540
     aaggccagca agatggccgc ggccatcgat ggcgtgcagt ccctgaactt acgcctcata       600
     cagcttttcc ctaagtcccc ccacaagacc accaactgcg tctcttcggc catcacattc       660
     gccgcgaggc cggacgccgt cgacagtctc atcaagagcg tggtcgccac cgtgaagagg       720
     gagacccgct cgagtaagac gggcatcgcc gtgtaccgcg gcatcggcat ttccccggcg       780
     ctcaacgcct tcggctggga ggtcaagaag cacctcgtca ccgttgagac ggtcgaggag       840
     aacgcgaagg gcacgggcat cgagttcatc gacctcttcc cgaatcgcga gggccgcatc       900
     ggcgctctcg ccgccgtggc gctgtccgag gagaggacgg acgctgccgc gctgtataac       960
     gactgcgctt tgcccctcat ccggagatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page