(data stored in ACNUC10043 zone)

EMBL: AP011532.PE28

AP011532.PE28        Location/Qualifiers
FT   CDS_pept        20290..20700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0028"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60100"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH8"
FT                   /protein_id="BAI60100.1"
FT                   /translation="MIERLTHVTVLVRDSDEALKFYTEKLGFEKVEDSKMPTGDRWLTV
FT                   RPKGGDVQIVLQQPGAATFGEEGAKEMLRRVGQGTTWAFKVDDCQGTCDELVKKGVKIL
FT                   SSPQDFGFAVEAIFADLYGNAYILMQPPAGPK"
     atgatcgaga ggctcacgca cgtgaccgtg cttgtcaggg acagcgacga ggcgctgaag        60
     ttctacacgg agaagctggg gttcgagaag gtcgaggact caaagatgcc cacgggggac       120
     cggtggctga ccgtcaggcc gaagggaggc gacgtgcaga tcgtgctcca gcagcccggc       180
     gcggccacgt tcggggagga gggcgcgaag gagatgctca ggcgggtcgg ccagggcacc       240
     acctgggcgt tcaaggtgga cgactgccag gggacgtgcg acgagctcgt gaagaagggc       300
     gtgaagatac tcagctcccc tcaggacttc gggttcgccg tcgaggcgat cttcgccgac       360
     ctctacggga atgcctacat cctcatgcag ccccctgcag gcccaaaata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page