(data stored in ACNUC10043 zone)

EMBL: AP011532.PE283

AP011532.PE283       Location/Qualifiers
FT   CDS_pept        287317..288564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60355"
FT                   /db_xref="GOA:D1YV83"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV83"
FT                   /protein_id="BAI60355.1"
FT                   /translation="MADVDLKYGKGHFEVNVPDKNMAGIILPKEMTGVKDEQAEIRRAL
FT                   ENPIGSQRLREKVKKGMKVVVIISDATRPCPSYKFLPLLLDEINAGGVPDGDITVVIAL
FT                   GSHRRSTPEEQKALMGPAFGRVRNIGHDKHDCKYVGTSSFGHRIEIFKEVVDADFIVCT
FT                   GNTEYHYFAGYSGGAKAVLPGCASHSTIEINHAMMVDPKAETGRLDSPIRQEIDEVPGM
FT                   MRNIGFLLDVVLNSKKEIVAAVAGDVMEAHREGVKYVDRMYSVKVPKADIVVTSAGGYP
FT                   KDINMYQAQKAMDNCKHVVKEGGTMILAAQCQECLGNDVFACWVDEATTIEAQARRMDE
FT                   HFELGGHKASVIAKTAMKCDIQLISEIPGETVRKMFLTPVKSPQEALDAALKKYGPDAK
FT                   VLVSPYGGMVLPKPLE"
     atggcagatg tagatctcaa atacgggaag ggccacttcg aggtgaacgt gccagataag        60
     aacatggccg gcatcatcct gcctaaagag atgacgggcg tgaaggacga gcaggccgag       120
     atacgcaggg cgctggagaa ccccataggc tctcagaggc tcagggaaaa ggtgaagaag       180
     ggcatgaagg tcgtcgttat cataagcgac gccacccggc cctgcccctc gtataaattt       240
     ttaccgttat tactggacga gatcaacgcg ggaggcgtgc cggacgggga catcaccgtt       300
     gtcatcgccc tcggcagcca taggcgctcc acgcccgagg agcagaaagc cctcatgggc       360
     ccggccttcg gccgcgtccg taatatcggc cacgataagc acgactgcaa gtacgtcggc       420
     acctccagct tcggccaccg catcgagatc ttcaaggagg tcgtcgacgc cgacttcatc       480
     gtgtgcaccg ggaacaccga gtaccactat tttgccggat attcgggagg cgccaaggcg       540
     gtacttccgg gatgcgcaag ccactcgacc atcgagatca accacgcgat gatggtagat       600
     ccaaaggcag agacggggag gctcgacagc cccatacggc aggagatcga cgaggtcccc       660
     ggcatgatga ggaacatcgg cttcctcctg gacgttgtcc tgaacagcaa gaaggagatc       720
     gtcgcggccg tcgcggggga cgtgatggag gcccacaggg agggtgtcaa gtacgtcgat       780
     cgcatgtaca gcgttaaagt gccgaaggcc gacatcgtgg tcaccagcgc cggcggctac       840
     cccaaggata tcaacatgta ccaggcgcag aaggcgatgg ataactgcaa gcacgtcgta       900
     aaagagggcg gcaccatgat cctggcggcg cagtgccagg aatgcctggg gaacgacgtg       960
     ttcgcctgct gggtggacga ggccacgacc atcgaggccc aggcacggcg gatggacgag      1020
     cacttcgagc tcggcgggca caaggcgtcc gtcatagcaa agaccgccat gaagtgcgac      1080
     atacagctta tctctgagat tcccggggag acggtgcgca agatgttcct caccccagtg      1140
     aagtcgcccc aggaagccct ggacgcggcc ctgaagaagt acgggccgga tgcaaaagtg      1200
     ctcgtctcac catatggcgg catggtgctc ccgaagccgc tcgaataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page