(data stored in ACNUC10043 zone)

EMBL: AP011532.PE286

AP011532.PE286       Location/Qualifiers
FT   CDS_pept        289811..291985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Amylo-alpha-1,6-glucosidase family
FT                   (IPR010401)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60358"
FT                   /db_xref="GOA:D1YV86"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV86"
FT                   /protein_id="BAI60358.1"
FT                   /translation="MAYEQEFASQAKIHEAHTVIKDILGALVIRDGPLTLVTAQNGDIP
FT                   VRENHGFGLYYRDCRFLSGYVLTCNGRQPISILSSDDKSYAGITVLTNQRYVDRGGRTV
FT                   EKETLGIRRDRIIPGMLDEKITVTNYNEFEADVELALEFVSDFDDIFTVRGITQPTKGR
FT                   VLAPAYEPGQLTLQYIGEDGHRRNTRITFDPAPSDVKGGIALFRLRVGPRKRDTIGVRI
FT                   YVEDMPPDVPSVLDDQHIQRRIRGIKASYADTMECCSNIQTDNGIFNKIFLRSLSDLRM
FT                   LYMGQPVNIFYSAGVPWYDALFGRDSIISAMQVIPYNPEVARSTLKVLAGLQGGKTDDW
FT                   RDEQPGKILHELRVGEQANLNNIPDTPYYGSVDSTPLFLILLADYIDWTGDMGLFNELQ
FT                   GNVDAALRWIDAYGDLDGSGLISYTRKSTKGLYNQCWKDSFDSISHADGSLAVHPIAAA
FT                   EVQGYVYMAKRRMANLFERVGRHGDASRLRRDAVNLRWKFNNDFWMKGEKYFAEAIDKN
FT                   GQCDVVTSNPAQGLWSEIIEPQKARMVVDRIFREDMFSGWGIRTLSYKEKRYNPLGYHN
FT                   GTIWPHDNSIIAMGLNKYGFKEELAVLFTCMYEAAGFYPIYRLPELFGGFQRGEYDVPI
FT                   KYPVACSPQAWSAGTIPYMLSASLGFIPDALNMRLTLYKPKLPPWLHTVKISKLIVGDA
FT                   YTQLEFKREGESTLVNVVDKRGSLEVQVVY"
     atggcgtatg agcaggagtt cgcgagccag gcgaagatac acgaggcaca cacagtcatc        60
     aaggacatac tgggcgcgct ggtcatacga gacggcccgc tcacgctggt caccgctcag       120
     aacggagaca tccccgtccg cgagaaccac ggcttcggcc tgtactaccg ggactgcagg       180
     ttccttagcg gctatgtgct gacgtgcaac ggcaggcagc cgatcagcat attgtcaagc       240
     gacgataaga gctatgcggg catcacggtg ctcacgaacc agcgctacgt cgaccggggc       300
     ggaaggaccg tggaaaaaga gaccctcggc attcgccggg accgtatcat ccccgggatg       360
     ctcgacgaga agataaccgt gacgaactat aacgagttcg aggcggacgt ggaactggcc       420
     ctcgagttcg tgtccgattt tgacgacatc ttcaccgtca ggggaattac acagcccacg       480
     aagggcaggg tactcgcgcc cgcatatgag cccgggcagc tcacgctaca gtacatcggg       540
     gaggacgggc acaggcggaa cacccggatc accttcgatc cggccccatc ggacgtgaag       600
     ggcggcatcg cgctcttcag gctccgggtc gggccccgga aaagggacac gatcggcgtc       660
     cggatctacg tggaggacat gccccccgac gtgccgtcgg tcctggacga ccagcatata       720
     cagcggcgta tccgcgggat caaggcctcg tacgccgaca cgatggaatg ctgcagcaac       780
     atccagacgg ataacggcat cttcaacaag attttcctgc gctccctgtc cgacctcagg       840
     atgctctaca tggggcagcc ggtcaacatt ttttattctg ccggagtgcc ctggtatgat       900
     gccctcttcg ggagggacag catcatctcc gccatgcagg tcatacccta taacccggaa       960
     gtggcccgga gcacgctgaa ggtgctggcg ggcctgcagg gcgggaaaac ggacgactgg      1020
     agggatgagc agccaggcaa gatactccac gagctccggg tgggcgagca ggcgaacctc      1080
     aacaacatcc ccgatacgcc gtattacgga agcgttgact cgacgccgct ctttctcata      1140
     ctgctggcgg attatatcga ctggaccggc gacatgggcc tttttaacga gctgcagggg      1200
     aacgtcgacg cggcgcttcg atggatcgac gcctacgggg acctggacgg ctcggggctt      1260
     atctcgtaca cgagaaagtc cactaaaggc ctgtataacc agtgctggaa ggactccttc      1320
     gactctatca gccatgcgga cggcagcctg gccgtccacc ccatcgccgc cgcggaggtg      1380
     caggggtacg tttacatggc aaagcggcgc atggcgaacc tgttcgagcg cgtcgggcgc      1440
     cacggcgacg cgagccgcct gaggcgggac gccgtgaacc tgcgatggaa gttcaacaac      1500
     gacttctgga tgaagggcga gaagtacttc gccgaggcca tcgataagaa cggccagtgc      1560
     gacgtggtca cctcgaaccc tgcccagggg ctctggagcg agatcatcga gccccagaag      1620
     gcccggatgg tcgtcgaccg gatattccgg gaggacatgt tctccggctg ggggatccgc      1680
     acgctgtcct acaaagagaa gcgctataac ccgctagggt accataacgg cacgatatgg      1740
     ccccacgata actcgatcat cgccatgggc ctgaataagt acggtttcaa agaggagctc      1800
     gccgtgctct ttacctgcat gtacgaggcg gccggctttt acccgatata ccgtttgcct      1860
     gaactattcg gcggcttcca gcgcggagag tacgacgtgc cgatcaagta cccggtcgcc      1920
     tgcagcccgc aggcgtggtc ggccgggacg ataccctaca tgctctcggc atcgctgggc      1980
     ttcataccgg acgccctcaa catgcgcctc acgctataca agcccaaatt accgccctgg      2040
     ctgcacacgg taaagatcag caagctgatc gtcggagacg cttacacgca gctcgagttc      2100
     aagcgggagg gcgagagcac gctggtcaac gtcgtcgata agaggggcag cctcgaagtc      2160
     caggtcgtgt attga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page