(data stored in ACNUC10043 zone)

EMBL: AP011532.PE287

AP011532.PE287       Location/Qualifiers
FT   CDS_pept        complement(292197..293447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60359"
FT                   /db_xref="GOA:D1YV87"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV87"
FT                   /protein_id="BAI60359.1"
FT                   /translation="MVDLLLLQKLFTALLIGLVIGLEREIAQEGRQNVKFAGLRTFGIV
FT                   GLIGGIAAYLTTQGYIIFVAALLGVIALTAIAYYRSTGIDKHLGFTTETALILTFLLGG
FT                   LAYFEQTVAIILAIVVTILLAFKVPLHEFTFKIPKEEFYDSLKFALIALVILPVLPDQA
FT                   FGPLEAFNPYQIWLIVVILTGISFVGYFLVKWFGADLGLSLTGIVGGLASSTAVISSMA
FT                   IRTRENKEIERPAMVAATLASMVMLLRVVFMVFIFNPGLLVSIYLPIGIMCVASILVAS
FT                   YFYLQGRDGRKGETIKLKTPFNIVPALIFAGFIAIVLFVSKAALLYLGNYGLYITSALA
FT                   GLADVDAITVSTSQLAANGLASAPTAVTAIMIAVFVNLAIHTAYAFYFGTRKFGIYNAA
FT                   MSAVIIAAGIAVIAATL"
     atggtcgacc tgctgctcct ccaaaaactt ttcacggcgt tgctcatcgg cctggtgatc        60
     gggctcgaga gggagatcgc ccaggagggc aggcagaacg tcaagttcgc gggccttagg       120
     accttcggca tcgtggggct catcggcggc atcgccgcct acctgaccac gcagggctac       180
     atcatcttcg tcgcggccct gctcggcgtc atcgcgctca cggccatcgc atattaccgt       240
     agtacgggca tcgataagca cctcggcttc accaccgaga cggccttgat attaacgttc       300
     cttctgggcg ggctcgccta cttcgagcag acagtggcca tcatcctggc catcgtcgtg       360
     accatactgc tcgctttcaa ggtgcccctc cacgagttca ccttcaagat accgaaggag       420
     gagttctacg actccctcaa gttcgcgctc atcgcactgg tcatcctgcc ggtgctgccc       480
     gatcaggcct ttgggccgct ggaagcgttc aacccttacc agatctggct catcgtggtc       540
     atcctcaccg ggatcagctt tgtcggctac ttcctggtaa agtggttcgg ggcggacctg       600
     ggcctctcgc tcaccggcat cgtgggcggc ctggcgtcca gcaccgccgt catctcatcg       660
     atggccatca ggaccaggga aaataaggag atcgagcgcc ccgccatggt cgcggccacg       720
     cttgccagca tggtcatgct cctgcgcgta gtgttcatgg tctttatctt taacccgggg       780
     ctcctcgtca gcatctacct gcccatcggc atcatgtgcg tggccagcat actggtggcg       840
     tcgtactttt acctccaggg ccgggacggc cgcaagggcg agacgatcaa gcttaagacg       900
     cccttcaaca tcgtgcccgc gctgatcttt gcggggttca tcgccatcgt cctgttcgtg       960
     tccaaggcgg cgctcctgta cctgggcaac tatggcctgt acattacgtc cgccctcgcc      1020
     ggcctggccg acgtcgacgc catcaccgtc tcaacatccc agctggcggc taacgggctg      1080
     gcgtccgcgc ccacggcggt cacggcgata atgatcgcgg tcttcgtgaa cctggcgata      1140
     cataccgcct acgcctttta cttcggcacc cggaagttcg gcatctacaa cgcggccatg      1200
     tccgcggtca tcatcgccgc gggcatcgcg gtcatcgccg cgaccctatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page