(data stored in ACNUC10043 zone)

EMBL: AP011532.PE291

AP011532.PE291       Location/Qualifiers
FT   CDS_pept        complement(295536..296642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF373
FT                   family (IPR007254)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60363"
FT                   /db_xref="GOA:D1YV91"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV91"
FT                   /protein_id="BAI60363.1"
FT                   /translation="MDILVICIDKDDDIGVKGGVKSPVIGRAACLDAACRLGTADPEDS
FT                   DTNTIFGGIQAFDQLKAEGHNVELVCIAGHRELGIKSDRAIAAQLDDILLKYPTERAIL
FT                   VSDGAEDESVLPILQSRLKIESVKRVVVKQAQNLESTYYIIKQLINDPKVAKVIFIPIG
FT                   LILLVYAATTWIDWPNATPIAIALLLGGYLLYRGMGLDNLFDTFIFNMRRSFSESKLTF
FT                   VTYLLALVLSIMAFIMGAWGVAQWQNDLPGVLSPGLLDYAAIFVSHSVLWFIAAFLAIV
FT                   IGWIVDAYADESDTLYRYLSTPFFLLAGGLLIWGSSQYILHMSNTVQAFESLVISIVLA
FT                   VVVSYVGVQFANQVRQIMQYRTVEVIDF"
     atggacatat tagtcatttg catcgataag gacgacgata tcggcgtcaa gggcggcgtg        60
     aagagccccg tcatagggcg ggccgcgtgc ctggacgccg cctgcaggct cggcacggcg       120
     gacccggagg actccgatac gaacaccatc ttcgggggca tccaggcctt cgaccagctg       180
     aaggccgaag gccataacgt ggagctggtc tgcatcgcgg gccaccggga gctgggcatc       240
     aagtccgacc gggccatagc ggcgcagctc gacgatattc tcttaaaata cccgaccgag       300
     agggcgatcc tggtatcgga cggcgccgag gacgagtccg tcctgcccat cctccagtcc       360
     cgcctgaaga ttgagtcggt caagagagtg gtcgtcaaac aggcccagaa cctcgaaagt       420
     acttattata tcatcaagca gctcatcaac gaccccaagg tcgccaaggt catcttcatc       480
     cccatcggcc tgatcctgct cgtctacgcg gccacgacct ggatcgactg gccgaacgcc       540
     accccgatcg ccatcgcgct gctccttgga ggctacctcc tgtacagggg aatgggcctc       600
     gacaacctgt tcgacacctt catcttcaac atgaggcggt cattctcgga gtccaagctc       660
     accttcgtca cttatctact ggcgctggtg ctcagcatca tggcgttcat catgggcgcc       720
     tggggcgtgg cgcagtggca gaacgacctg ccgggcgtgc tgtcccccgg ccttctcgac       780
     tacgcggcca tcttcgtgtc ccactcggtg ctctggttca tcgccgcctt cctggccatc       840
     gtcatcggct ggatcgtgga cgcctacgcg gacgagagcg acacgctgta ccgctatctt       900
     tcaacgccgt tcttcctgct ggccggcggg ctgctgatct ggggaagctc ccagtacatc       960
     ctccacatgt ccaacaccgt gcaggccttc gagagcctgg tcatctcgat cgtgcttgcg      1020
     gtggtcgtga gctacgtggg cgtgcagttc gctaaccagg taaggcagat catgcagtac      1080
     cgcacggtag aggtaataga cttttaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page