(data stored in ACNUC10043 zone)

EMBL: AP011532.PE296

AP011532.PE296       Location/Qualifiers
FT   CDS_pept        complement(300556..301401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60368"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV96"
FT                   /protein_id="BAI60368.1"
FT                   /translation="MTEVSEIMTAPVYAVSPRDNVARARNLMLRYGVSRLVVAEGNTLR
FT                   GIVTRKDIGSRLSQAEPQWRRRPIDQIPVDLVATHDVFTVKPDAQIQDVASTMLCHDIS
FT                   GLVVYDSEIRGIVTKHDMVKYFTLLGSPLRVGDMMSEKVVTVSRHHTINSVIDIMAENG
FT                   VDRVIVRDGGPAAAYAGMVTLDDLGFATMDFRDTKPIKEAHRMVQGGPKMLRGFREAMM
FT                   VAEDVMSTPLVSVNRGTKALDAAKLMLEHNYDMLPVIDSELLGEFSVESILKWLSEARE
FT                   "
     gtgaccgagg tcagcgagat catgacggcg ccggtgtacg ccgtaagccc cagggacaac        60
     gtggcccggg ccaggaacct tatgctgagg tacggggtgt cccgcctcgt ggtcgcagaa       120
     ggcaacaccc tcaggggcat cgtcaccagg aaggacatcg gctccaggct gagccaggcg       180
     gagccccagt ggcgacggag gcccatcgac cagataccgg tcgatcttgt ggccactcac       240
     gacgtgttca cggtaaagcc cgatgcgcag atacaggacg tggcctccac gatgctctgc       300
     cacgacatct cgggcctggt cgtgtacgac agcgaaatcc gggggatcgt gaccaagcac       360
     gacatggtca agtacttcac gttattgggg agtcccctga gagtcgggga tatgatgtcc       420
     gagaaagtag tgacggtcag ccggcaccac acgatcaaca gcgtcatcga tatcatggcg       480
     gagaacgggg tcgaccgggt catcgtcagg gacgggggcc ccgcggcggc gtatgccggc       540
     atggtcacgc tggacgacct ggggttcgcc accatggact tcagggatac gaagcccatc       600
     aaggaagcgc accggatggt gcagggcggg cccaagatgc tccggggatt ccgggaggcg       660
     atgatggtcg ccgaggacgt gatgagcacg cccctggtgt ccgtcaacag gggcacgaag       720
     gcgttagacg ccgcgaagct catgctcgag cataactacg acatgctgcc cgtcatcgac       780
     tcggagcttt taggagagtt cagcgtagag agcatcttga agtggctatc ggaggcccgg       840
     gaatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page