(data stored in ACNUC10043 zone)

EMBL: AP011532.PE297

AP011532.PE297       Location/Qualifiers
FT   CDS_pept        complement(301398..302375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60369"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV97"
FT                   /protein_id="BAI60369.1"
FT                   /translation="MSREGIKEFGDQRRERKVNTGKFEHDLRESQVTRDLNFKQRQAQH
FT                   ESGIMAVAKKAVVTVPPTTTVMGAARTMVGYGYRRLPVADAGTKRLKGICTVIDIIDFL
FT                   GGGEKRRIIDRVYDGNMIVAINGPITEIMEEDVATVQDDASLDDAIKVMIDRSVGGVPV
FT                   IDPESIVVGIITERDIVRLMGDSVSGTKVRDIMSRRVTTAPPNMPIETAAKTMIESGFR
FT                   RLPVVTDSYVCGIITATDIMRYLGNGEAFKKLVTGNVSEAFSVPISGIMKSDIVTVGPD
FT                   QDLGETARIMRQNKIGSLPVIENQQLVGIVTERDVLMSMKGGKA"
     atgagccggg agggcatcaa ggaattcggc gaccagcggc gcgagaggaa ggtgaacacg        60
     ggcaagttcg agcacgacct ccgcgagagc caggtgaccc gtgatctgaa ttttaagcag       120
     cgccaggcgc agcacgagag cggcatcatg gccgtcgcga agaaggccgt ggtcacggtg       180
     ccgcccacca ccacggtcat gggcgcggcc cggaccatgg tcggatacgg ctatcgccgc       240
     ctgccggtcg cggacgcggg cacgaagcgc ctgaagggca tctgtacggt catcgacatc       300
     atcgactttc tcggaggcgg cgaaaagcgc cgcatcatcg accgggtcta cgacggcaac       360
     atgatcgtgg ccatcaacgg cccgatcacg gagataatgg aagaggacgt ggccaccgtc       420
     caggacgacg cctcgctcga tgacgccata aaggtgatga tcgaccgctc ggtgggcgga       480
     gtgcccgtca tcgaccccga gagcatcgtc gtcgggatca tcacggagcg ggacatcgtg       540
     cgcctcatgg gggactccgt atcaggaaca aaggtgaggg acatcatgag caggagagtc       600
     accacggctc ctcccaacat gcccatcgag acggcagcta aaacgatgat cgagagcggc       660
     ttccgccggc ttcccgtggt aacggacagc tacgtctgcg gcatcatcac ggccacggat       720
     atcatgcgct acctggggaa cggcgaggcg ttcaagaagc tggtcacggg caacgtcagc       780
     gaggcgttct ccgtccccat cagcggcatc atgaagagcg acatcgtcac cgtggggccg       840
     gaccaggacc tgggcgagac ggcccggatc atgcggcaga ataagatagg gtcgctgccc       900
     gtcatagaga accagcagct cgtggggatc gtcaccgagc gggacgtcct catgtcgatg       960
     aaaggaggca aagcgtga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page