(data stored in ACNUC10043 zone)

EMBL: AP011532.PE306

AP011532.PE306       Location/Qualifiers
FT   CDS_pept        complement(307718..307906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60378"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA6"
FT                   /protein_id="BAI60378.1"
FT                   /translation="MPAASMQKPARPGSSEELLDAAIDTVYTKLKHVNHSSHIVALSQE
FT                   LRELLKMRNEMGYEKQR"
     atgcctgcag catcaatgca aaagcccgcg cgcccgggct ccagcgagga gctcctggac        60
     gcggcgatcg ataccgtcta cacgaagcta aagcacgtca accactcgtc gcacatcgtc       120
     gccctcagcc aggagctcag ggaattactg aagatgagga acgagatggg ctatgaaaag       180
     cagcgttag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page