(data stored in ACNUC10043 zone)

EMBL: AP011532.PE311

AP011532.PE311       Location/Qualifiers
FT   CDS_pept        312469..313818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60383"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB1"
FT                   /protein_id="BAI60383.1"
FT                   /translation="MTRILPGVEIQVIKEIVPQQLNPSGVVALIGTTEKGEALVPTPVS
FT                   SYAEFADKFGSSESFTVTKDAKQAFQNGVFQVVVVPISGQNGTKGTLVLKDRKGRDTVL
FT                   LTAKSSGEEGNKIMVKVEGDADSIRVSVSDGASLEIYEDVTMNSSSQNYLVDIINQRSA
FT                   MVTAEDQHSSAKFPHNNPAAVEGQLSGGVTGVISKADYEAALDKLEGEPDVDIVAACEV
FT                   SDPEIHALIEAHCLKMSIDAKNRIGLGSVAKGESIKDICNRTTVMASDRFVIVAPYGCL
FT                   GAVAGLMSRLNYYESPTFKPVSGLAKLEKKYTPSEQMEMLKAGVLPLEAQKGRGIVVVK
FT                   GISTSKEQISVTRIADHAVRGVKSVSDLFIGTLNSPTGRAALKGKIIEFFMRMESEGAI
FT                   VPSTDGKEPPFLVDVYSSELDFAQGIVRVNIAVRPVRAMDYIYATIKVEA"
     atgacaagaa tattgccggg agtcgaaatt caggtaatca aggagatcgt gccccagcag        60
     ctgaaccctt caggcgtcgt ggccctcata gggacgacgg agaagggcga ggcgctggtg       120
     cccacacctg tgagcagcta cgcggagttc gcggacaagt tcgggtcgag cgagagcttc       180
     accgtcacga aggacgccaa gcaggccttc cagaacggcg tgttccaggt agtcgttgtg       240
     cccatcagcg gccagaacgg cacgaagggc acgctcgtgt tgaaggatag aaaggggcgg       300
     gacacagtgc tcctgaccgc gaagtcgtcg ggcgaggagg gcaacaagat catggtgaag       360
     gtcgagggcg acgccgactc gatacgggta tccgtgtcgg acggggcgag cctggagatc       420
     tacgaggacg tgaccatgaa ctcgtcgagc cagaactatc tcgtggacat catcaaccag       480
     aggtccgcca tggtaacggc cgaggaccag cattcgagcg ccaagttccc gcacaacaac       540
     cccgcggccg tcgaaggcca gctttcgggc ggggtcacgg gcgtcatttc taaggccgac       600
     tacgaggccg ccctggacaa gctcgagggc gagccggacg tggacatcgt ggccgcctgc       660
     gaggtcagcg atccggagat ccacgcgctg atcgaggccc actgcctgaa gatgagcatc       720
     gacgccaaga accgcatagg ccttggctcg gtcgcgaagg gcgagagcat caaggacatc       780
     tgcaaccgca cgacggtcat ggcgagcgac aggttcgtca tcgtggcgcc atacggctgc       840
     ctgggagcgg tggccggcct gatgagcagg ctgaactatt acgagtcgcc gacgttcaag       900
     ccggtaagcg gcctggcaaa gctggagaag aagtacacgc cctcggagca gatggagatg       960
     ctcaaggcgg gcgtgctgcc cctggaagcc cagaaaggcc ggggcatcgt ggtcgtcaag      1020
     ggcatatcca cgagcaagga gcagatcagc gtcacccgca tcgcggacca cgcggtgagg      1080
     ggcgtaaaga gcgtgtccga cctgttcatc ggtacgctca acagcccgac gggcagggcc      1140
     gcgctgaagg gcaagatcat cgagttcttc atgaggatgg agtccgaggg cgccatcgtc      1200
     ccgagtacgg acggaaagga gccgccattc ctggtggacg tctacagctc cgagctggac      1260
     ttcgcccagg gcatcgtgcg cgtgaacatc gcggtgaggc cggtccgggc gatggactat      1320
     atctacgcga ccatcaaggt cgaggcgtga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page