(data stored in ACNUC10043 zone)

EMBL: AP011532.PE312

AP011532.PE312       Location/Qualifiers
FT   CDS_pept        313829..314242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60384"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB2"
FT                   /protein_id="BAI60384.1"
FT                   /translation="MAVQLFSARWSNVTITPSMGGSSETVGVQSIEYSINLNKEDHFEG
FT                   GSHLRTYVSYGYKQVKGKIQVKSVSTVLDALLDKMEEMNNSFSLHVDLSNGTDHKVLDF
FT                   FECYLESKEFGIDVNGNGISTYSFTARDVKEGA"
     atggctgtac agttattttc tgcacggtgg agcaacgtga ccataacgcc gtccatgggc        60
     ggcagctccg agacggtggg agtccagtcg atcgagtact ccataaacct gaacaaggag       120
     gaccactttg agggcgggag ccacctgagg acctacgtgt cctacggata caagcaggtc       180
     aagggcaaga tccaggtcaa gtccgtgagc acggtgctcg acgccctgct ggacaagatg       240
     gaggagatga acaacagctt ctcgctgcac gtggacctct ccaacggcac ggaccacaag       300
     gtcctcgact tcttcgagtg ctacctcgag agcaaggagt tcgggatcga cgtcaacggc       360
     aacggcatat cgacgtactc cttcaccgcg agggacgtca aggaaggcgc gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page