(data stored in ACNUC10043 zone)

EMBL: AP011532.PE313

AP011532.PE313       Location/Qualifiers
FT   CDS_pept        314260..314616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60385"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB3"
FT                   /protein_id="BAI60385.1"
FT                   /translation="MKKLTKEDILKGKDKRETFRVDAYDSDVVLRPLTDGELSEVFAVI
FT                   GNVPLKSDGTPDGGQVDIVKNFKALRLVTSLGLVEPKLSVDEVGDMKFGVPEQIGTRIL
FT                   EISGISSAVKKELR"
     atgaaaaaac tgaccaagga agacatcctg aagggcaagg ataagcgcga gacgttccgc        60
     gtcgacgctt acgattccga cgtcgtcctg cggcccctga ccgacggcga gctcagcgaa       120
     gtgttcgccg tcatcggcaa cgtccctctc aagagcgacg gcacgccgga cgggggccag       180
     gtcgacatcg tcaagaactt caaagcgctg cggcttgtca cgtccctggg cctcgtcgag       240
     ccgaagctca gcgtggacga ggtcggcgac atgaagttcg gcgtcccgga gcagatcggc       300
     acgcgcatcc tggagatcag cggcatatcc tcagctgtaa aaaaagagct gagatga          357
//

If you have problems or comments...

PBIL Back to PBIL home page