(data stored in ACNUC10043 zone)

EMBL: AP011532.PE314

AP011532.PE314       Location/Qualifiers
FT   CDS_pept        314613..314837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60386"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB4"
FT                   /protein_id="BAI60386.1"
FT                   /translation="MKRFVRSPEGQELAMLCLDFGYKLADRPGDLTRPQINFLALALSD
FT                   RLERINLARSDRPGVNKIVFVDDDEDEEE"
     atgaagaggt tcgtcaggtc ccccgagggc caggagctcg ccatgctgtg cctggatttc        60
     gggtacaagc tggccgacag gcccggggac ctcacccgcc ctcagatcaa ctttcttgcc       120
     ctggcgctct cggaccggct ggagaggata aacctcgcca ggtccgaccg gccgggagtg       180
     aataagattg tcttcgtgga cgatgacgag gatgaagagg aataa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page