(data stored in ACNUC10043 zone)

EMBL: AP011532.PE317

AP011532.PE317       Location/Qualifiers
FT   CDS_pept        318325..319557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60389"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB7"
FT                   /protein_id="BAI60389.1"
FT                   /translation="MPPSAKLLPKMPLPKKPLPAIPKIKKPLPKIPLSSRYRPIYKVTI
FT                   KTPQGKQYEYNSWYYKDPTGIKTKQNNKLAIYIDRDLEKKLDVCLMNISLRSGDLIDTA
FT                   KSPKFGDIRIGSVIKVYLGYANVNEENPSLKESDIAFAGIIDEISHSFKKISITAFSMA
FT                   YKIIFKKADPKKFEGDDWKKNEKSSKDIITTLLEKKLDVDKIDEGLKFTAYTPSDEQSI
FT                   YDNIKTLADCNGFLFYISKDGKARIHEKSSRAHSFKYGEDILENSITMSKPAYDKVEVK
FT                   FTYKKDGKDTSVLSSKPIAGSTLAKDKKEETKNIDFGLADDVNTAKKIAENILRGIYVI
FT                   ETGEVKVIGNTGVDLGDELTISFDSSAPGAKELDYMKRDKVVITRVTHKYGKKSGFTTT
FT                   IGWKKFEKKKP"
     ttgccgccat ctgctaaact gctgccaaaa atgccgctac ctaaaaaacc actacctgca        60
     ataccaaaaa ttaaaaagcc gttacctaag ataccgttat cgagccgtta ccggccgatc       120
     tataaggtaa cgatcaagac gccccaggga aagcagtacg aatataactc gtggtattac       180
     aaggacccta cgggcattaa aacgaagcag aacaataagc tggccatcta tatcgatcgc       240
     gacctggaga agaagctgga cgtatgcctg atgaacatct ccctccggag cggggacctg       300
     atcgacactg ccaagagccc gaagttcggc gacatccgga tcggctccgt gatcaaggta       360
     taccttggct acgcgaacgt gaacgaagaa aacccgagcc tcaaggaaag cgatattgcg       420
     ttcgccggca tcatcgacga gatctcccac agcttcaaga agatctcgat caccgcgttc       480
     agcatggcct acaagatcat ctttaaaaag gcggacccga agaagttcga aggggacgac       540
     tggaaaaaaa atgaaaaatc ctcaaaggac atcatcacga ccctgctgga aaagaagctg       600
     gacgtcgata agatcgacga aggcctgaag ttcacggcct atacgcctag cgatgaacag       660
     tcgatctacg ataatatcaa gacgctggct gactgtaacg ggttcctctt ctatatctcg       720
     aaggatggca aggcccggat ccacgaaaag agctcccggg cccattcgtt caaatatggc       780
     gaggacatcc tggagaacag catcaccatg tccaagcccg cttacgataa ggtcgaggtc       840
     aaattcacct ataaaaagga cggcaaagat actagcgtcc tctcatctaa gccgatcgcc       900
     ggcagcaccc tggcaaagga taaaaaagag gaaacgaaaa atatcgactt cggcctggcc       960
     gatgacgtga atacggcaaa aaagatcgcg gagaacatcc tccgcgggat ctacgtgatc      1020
     gagacgggcg aggtgaaggt catcgggaat accggcgtgg acctgggcga tgagctgacg      1080
     atctccttcg acagttcggc cccgggcgcg aaagagctcg attacatgaa gcgcgacaag      1140
     gtggtcataa ccagggtcac ccacaagtac gggaaaaaat cgggctttac cacgacgatc      1200
     ggatggaaga agttcgaaaa gaagaagcca tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page