(data stored in ACNUC10043 zone)

EMBL: AP011532.PE319

AP011532.PE319       Location/Qualifiers
FT   CDS_pept        320460..320855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least one PAAR repeat (IPR008727)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60391"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB9"
FT                   /protein_id="BAI60391.1"
FT                   /translation="MGMPAAKMGDKVMAVDTHIFLIPAPPGPPVPTPLPSPFNGTITGN
FT                   CSTNVIIEKKPAATVGSTAMNMPPHMPQGGPFQVPPTNQGQIIMGSPTVMINGKPAARN
FT                   GDTALTCNDPAPLPIGKIIAVGTVMIG"
     atgggcatgc cagcagcaaa gatgggagac aaagtgatgg ccgtggatac gcatatattc        60
     ctgatccctg cgccaccggg gcctccggta ccgacgcccc tgccgagccc gttcaacggc       120
     acgatcacag gtaattgcag cacgaacgtg ataatagaaa agaagccggc cgcaacggtg       180
     ggctcgacgg cgatgaacat gccgccccac atgccccagg gagggccgtt ccaggtgcct       240
     cccacgaacc agggacagat catcatgggc agcccgaccg tcatgatcaa cggcaagccg       300
     gcggcccgta acggggatac ggccctgaca tgtaacgatc cggcgccgct cccgatcggc       360
     aagataatcg cagtgggtac agtaatgata ggttag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page