(data stored in ACNUC10043 zone)

EMBL: AP011532.PE321

AP011532.PE321       Location/Qualifiers
FT   CDS_pept        321304..322842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Phage baseplate assembly predicted
FT                   J-like family (IPR006949)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60393"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC1"
FT                   /protein_id="BAI60393.1"
FT                   /translation="MSYVPKAYRDIADAILSQIASGVVEQKFTYLPDGGVYTLSYPEEK
FT                   TVVKVEGSLNGYPHVFTKDVDYLVSDHTLKWLQGSKPDGNTPFTVYHLAGTPVDITDVN
FT                   PGSVVRTIIESIAVEMGFLYTQMEAVYESSFIDTATEQALDLVVAMLGVTRKPAEHATG
FT                   DVTFGRSGEPKLLSVPNEAIVFDGKDAHALKNGMVKSVKSIEGQANGTAVQFAEGTDFR
FT                   LESDRIVWLQPGKRPDKSSVFYVNYSYYEKIIIPKDSEVSTYSRNSENIRSFKTIREAL
FT                   LTKNSAGKWEIIVPVVATVPGRAGNVFSGSISMMPTAIPGVDYVVNKSDIMGGAEVEGD
FT                   EELRDRAKRAMERAGKATTRALQLAVQAVEGVTGEVVVIDQPDGVPGIIQVIATGGDRE
FT                   EIENAIEETRSAGIRVELKRPVSVPLDVRLMVYTAAGAEIEAVRQGVDQAVRKYFASLE
FT                   IGDDVIISRIIEAAVSVSGVKDVREVTINDKAENVRIKRDEKGDCRLLELFMEA"
     gtgtcatacg tgcctaaggc atacagggat attgcggacg cgatactatc gcagatcgcc        60
     agcggcgtcg tggagcaaaa gttcacgtac ctgcctgacg ggggagtata caccctgtca       120
     tatccggaag agaaaacggt ggtcaaggtc gagggcagcc tgaacgggta cccccacgtg       180
     ttcacgaagg acgtggacta tttagtgagc gaccacacgc tgaaatggct ccagggctca       240
     aagcccgacg gcaacacccc gttcacggtt tatcacctgg ccgggacacc ggtggacatc       300
     accgacgtca acccgggcag cgtcgtccgg accatcatcg agtcgatcgc cgtcgagatg       360
     ggcttcctgt acacccagat ggaagcggtc tacgagtcga gcttcatcga taccgccacg       420
     gaacaggccc tcgaccttgt cgtcgccatg ctgggcgtca ccaggaagcc ggccgagcat       480
     gccaccgggg acgtcacctt cgggaggagc ggcgagccca agctgctgag cgtcccgaac       540
     gaggccatcg tattcgacgg caaggatgcc cacgcgctca agaacggcat ggtcaagagc       600
     gttaagtcca tcgaaggcca ggctaatggc acggcggtcc agttcgccga gggcacggac       660
     ttcaggcttg agagcgaccg gatcgtctgg cttcagccgg gtaagcgtcc ggataaaagc       720
     tcggtctttt acgtcaacta cagctattac gagaagatca tcataccaaa ggatagcgaa       780
     gtatccacct actccaggaa ctccgagaac atacggagct ttaagaccat ccgcgaggcc       840
     ctgctgacga agaactcggc cggcaagtgg gagatcatcg tgccggtcgt ggcgacggtg       900
     ccgggcaggg cggggaacgt cttttccgga agcatcagca tgatgcccac ggccataccc       960
     ggggtcgact acgtggtcaa caagagcgac atcatgggag gcgccgaggt cgagggcgac      1020
     gaggagctga gggacagggc aaagcgggcc atggagcggg ctggcaaggc gaccacgcgg      1080
     gcgctccagc ttgccgtcca ggccgtcgag ggcgtcacgg gcgaagtcgt ggtgatcgac      1140
     cagcccgacg gcgtgccggg catcatccag gtcatcgcca cgggtggaga ccgggaggag      1200
     atcgagaacg ccatcgagga gacccgctcg gccgggatac gcgtcgagct caagcggccc      1260
     gtttccgtgc cgctcgacgt ccggctcatg gtatacacgg cggcaggggc cgagatcgag      1320
     gcggtcaggc agggtgtcga ccaggccgtg cgtaagtact tcgcgtccct ggagatcggc      1380
     gacgacgtca ttataagccg catcatcgaa gcggctgtga gcgttagcgg agtaaaggac      1440
     gtgcgcgaag tgacgatcaa cgataaggcg gagaatgtcc gcatcaagag ggatgagaag      1500
     ggcgactgca ggctgctgga gctcttcatg gaggcatga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page