(data stored in ACNUC10043 zone)

EMBL: AP011532.PE333

AP011532.PE333       Location/Qualifiers
FT   CDS_pept        complement(339006..339734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60405"
FT                   /db_xref="GOA:D1YVD3"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD3"
FT                   /protein_id="BAI60405.1"
FT                   /translation="MDSIASASVKYGSSRTRELLFRPLDLKFWLLATLGLSAGDPRQAE
FT                   MCRLRPYYRGTRLLATMGVLIILPAFLIPFMAPFIGSGGALVLVVLYLVFVLAMCLASL
FT                   FLEVSLDAVFAIGHEAGCGFSDAFRAFARFVREDPGNAAGYMGAKLLVDTGAMTIVSLF
FT                   FLPALFTMVFILSSVLHTLQAGQAVSRATAFGGLALVAVFCAAAMLASGLLSVPLSAFY
FT                   GYYTEETVRRICPVSYAARR"
     atggactcca tagcatcggc ctcggtgaaa tatggcagca gccgcacccg tgagctgctc        60
     ttcaggcccc tcgacctgaa attttggtta cttgcgacgc tggggctctc tgcgggcgac       120
     ccgaggcagg ccgagatgtg ccgattgagg ccatattacc ggggcacaag gctcctggcc       180
     acgatgggcg tgctcattat actgccggcg ttcctcatcc cgttcatggc gccctttatc       240
     gggtcgggcg gagcgctcgt gctcgtcgtg ctttatcttg tattcgtcct tgccatgtgt       300
     ctcgccagcc tgttcctcga ggtgagcctg gacgccgtgt tcgccatagg tcacgaggcg       360
     ggatgcggct tttcggacgc ctttagagcc ttcgcccgct tcgtccggga agaccccggg       420
     aatgctgccg gctatatggg cgccaagctg ctcgtcgaca cgggggcgat gacgatcgta       480
     tcgctgtttt tccttcccgc tttatttact atggtattta tcctgtcgtc cgtgctgcac       540
     acgcttcagg cagggcaggc cgtttcgagg gcaacggctt ttggcgggct cgcgctcgtt       600
     gccgtgttct gcgcggccgc catgctcgcc tcggggctcc tgtcggtgcc gctgtcggcg       660
     ttctatggct actacacgga ggagaccgta cgacgaatat gtcccgtgtc ttacgccgca       720
     cgacgctaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page