(data stored in ACNUC10043 zone)

EMBL: AP011532.PE336

AP011532.PE336       Location/Qualifiers
FT   CDS_pept        complement(341131..342180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60408"
FT                   /db_xref="GOA:D1YVD6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD6"
FT                   /protein_id="BAI60408.1"
FT                   /translation="MTEWWAFKPITTAFEKAKKILLEPFNAWAWLKLMIIVFFVGTGSS
FT                   RISNQFSNMANYRTGPEDTAGIEQGITSLLSNSTILAIIIVAALLIILVAVLFAYLRNV
FT                   FSFVLIKALTSGDVHIIQPLKENLGRGFRLFVFTLAASILTLVVVLAFIAIAILLILLA
FT                   VQAGTSSAAGIVTLILVICVICLLILLMVLFSIAMGIFIGFTYDFVAPMVYFKGRGIVE
FT                   SWKWLWASIKKDWQQYGVYVITRWALELAVGLLSMIIIVPVALIFIAILVAGCILAAAV
FT                   AKTSVALAVVIGLVLLVVLALFLIALMAISMPIAVYFRYYSLDVLKHIDPSAVIYSERF
FT                   APPPATLPA"
     atgacagaat ggtgggcttt caagcctata actactgcat tcgagaaggc gaagaaaata        60
     cttctcgagc cgttcaacgc atgggcgtgg ctaaagctaa tgatcatcgt gttcttcgtg       120
     ggcacggggt ccagccgcat cagtaaccag ttcagcaaca tggccaacta tcgcacaggc       180
     ccggaggaca ccgcgggcat cgagcagggc atcacctcgc tcctctcgaa ctctacgata       240
     ctggcgataa taatcgttgc ggccttgctc ataattctcg tcgcggtcct gttcgcttac       300
     ctgcgcaacg tgttctcgtt cgtcctgatc aaggccctca cgtccggcga cgtgcacatt       360
     atccagcccc tgaaggagaa cctgggccgg ggcttcaggc tgttcgtctt cacgctggct       420
     gccagcatac tcacgctcgt cgtcgtactg gccttcatcg ccatcgccat cctgctgatc       480
     ctactcgctg tgcaggcggg cacctcctcg gcggcgggca tcgtcacgct catactggtg       540
     atctgcgtca tttgcctgct catcctgctg atggtcctgt tctccatagc gatgggcatc       600
     ttcatcggct tcacctacga cttcgtggcg cccatggtct actttaaagg caggggcatc       660
     gtcgagtcat ggaaatggct ctgggcgtcg attaagaagg actggcagca gtacggcgta       720
     tacgtgatca cgcgctgggc cctcgagctt gcggtcggcc tgctgtcgat gataatcatc       780
     gtgccggtgg ccctcatctt catcgccatc ctcgtggccg ggtgcatcct cgccgcggcc       840
     gtggcaaaga ccagcgtcgc gctcgcggtc gtcatcggcc tcgtactact ggtcgtgctg       900
     gcgctgttcc tcatcgccct catggccata tcgatgccca tcgcggtcta cttccggtac       960
     tactcgctgg acgtgctgaa gcatatcgac ccgtcggccg tcatctactc tgaaaggttc      1020
     gcgcctccgc cggcgacgct gcccgcgtga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page