(data stored in ACNUC10043 zone)

EMBL: AP011532.PE34

AP011532.PE34        Location/Qualifiers
FT   CDS_pept        25082..26992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0034"
FT                   /product="putative histidine kinase"
FT                   /note="Contains at least two PAS domains (IPR000014).;
FT                   Contains two PAS-associated, C-terminal domains
FT                   (IPR000700).; Contains one ATP-binding region, ATPase-like
FT                   domain (IPR003594).; Contains one histidine kinase A,
FT                   N-terminal domain (IPR003661).; Contains two PAC motif
FT                   repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60106"
FT                   /db_xref="GOA:D1YUI4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI4"
FT                   /protein_id="BAI60106.1"
FT                   /translation="MSFKPAPSNPPDAGRTTEELLSELQALRARNAALEESEQRYREAV
FT                   ESANSIIIRWDMEGNLTFFNEFAEKLFGFSEDEVLGRNVVGTIVPPSESTGRDLAAMID
FT                   DVLAHPERYELNINENICKNGERVTIAWTNRAIRDEHGNAVEILSVGNDITERRRAEES
FT                   LQFERLQLLSIFDSIDEVIYISDPCTYEILYANKAMQDKFGKSLIGGICYREIQDRDAP
FT                   CDFCTNGIILNNKDEPCRWEFHNPTVNRDFGIVDRIIKWPDGRDVRFEIALDITERNQA
FT                   SESLRESEEDLRAAFEQAAVGMTHVSSDGRFLKVNQKFCDITGYTREELLKMSAQDITH
FT                   PTDMDEEARLIESLLSGRLSTFSSEKRYIRKDGAVVWVNLTVTPIFHNGALAYLMGITE
FT                   DITGRKQAEAALQEAKAQAELYVDLMGHDINNIHQAALGYLELARDMPGDREEHLDMAI
FT                   EALMRSTRLISNVRKLQKIPNAGHAHEVDLCEVLGEVYGEYARSPGKTVMLSLNGREHC
FT                   HVLADDLLRDVFSNLVGNAVKHTGKRASVLISLDEAQEGGKAHYRVSVEDDGPGIRDEL
FT                   KKTLFSRSLKGSPRAKGMGLGLYIVKTLVGNYGGIIRVEDRVRGDHAKGARFVILLPMI
FT                   K"
     atgagcttta aacccgcccc ctccaaccct ccagacgcag gcaggacgac ggaagagctt        60
     ctatccgagc tccaggcgct acgggcccgg aacgccgccc tcgaggaaag cgagcagcga       120
     taccgggagg cggtcgagag cgccaacagc atcatcatcc gctgggacat ggagggcaac       180
     ttgactttct ttaacgagtt cgccgagaag ctgttcggct tttcggagga cgaggtgctg       240
     ggcaggaacg tggtggggac gatcgtgccc ccgtccgagt ccaccggccg cgacctggcc       300
     gccatgatag acgatgtcct ggcgcatccc gagcgctacg agctgaacat caacgagaac       360
     atctgcaaga acggcgagcg ggtaacgatc gcgtggacga accgggctat ccgcgatgag       420
     cacgggaacg ccgtggagat cctctccgtg ggcaacgata tcacggagcg ccggcgggca       480
     gaggaatccc ttcagttcga gcggctgcag ctgctgagca tcttcgacag catcgatgag       540
     gtcatctata tctcggaccc gtgcacgtac gagatcctgt atgcaaacaa ggcgatgcag       600
     gacaagttcg gcaagagcct cattggaggt atttgttata gggagatcca ggacagggac       660
     gccccttgcg atttctgcac gaacggcatc atcctcaata ataaggacga gccctgccgg       720
     tgggaattcc ataatcccac ggtgaaccgg gacttcggga tcgtggaccg gatcatcaag       780
     tggcccgacg gccgggacgt gaggttcgag atcgccctgg acatcaccga gcggaatcag       840
     gccagcgagt cgctccggga gagcgaagag gacctgaggg cggccttcga gcaggcggcc       900
     gtaggcatga cgcacgtgag cagcgacggc agatttttaa aggtaaacca gaaattctgc       960
     gacatcacag ggtatacccg ggaagagctt ttaaaaatgt ccgcccagga catcacgcac      1020
     ccgaccgaca tggacgagga agcccggctc atcgaaagct tattgtccgg ccggctgtcc      1080
     acattctcaa gcgaaaaacg ctatataagg aaggatggcg ccgtcgtctg ggtgaacttg      1140
     accgtcaccc ccatattcca taacggggcg ctggcgtacc tgatggggat caccgaggat      1200
     atcaccggcc ggaagcaggc tgaagcggcg ttacaggaag cgaaagccca ggccgagctt      1260
     tacgtggacc tgatgggcca cgacatcaac aacatccacc aggcggccct gggctacctg      1320
     gagctcgcac gggatatgcc cggcgatagg gaggagcacc tggatatggc tatagaggcc      1380
     ctgatgagga gcaccaggct catcagcaac gtgcgtaagc ttcagaagat cccgaacgcc      1440
     ggccatgccc acgaggtgga cctgtgcgag gtgctgggcg aggtgtacgg cgagtacgcg      1500
     aggtcccccg gcaagacggt gatgctgagc ctcaacggcc gcgagcattg ccacgtcctc      1560
     gcggacgacc tgctccggga cgtgttctcg aacctcgtgg gcaacgcggt gaagcacacc      1620
     gggaagcgcg cgagcgtcct catcagcctg gacgaggcac aggagggcgg gaaagcgcat      1680
     taccgggtct cggtggagga cgacggcccc ggcatccggg acgagctcaa gaagacgctc      1740
     ttcagccgct cgctcaaggg gtcgccacgg gcaaagggca tgggcctggg gctgtatatt      1800
     gtgaagacgc tcgtcgggaa ctatggcggc atcatacgtg tcgaggaccg cgtaagggga      1860
     gaccatgcga agggcgcccg gttcgtgatc ttgctcccta tgataaaata g               1911
//

If you have problems or comments...

PBIL Back to PBIL home page