(data stored in ACNUC10043 zone)

EMBL: AP011532.PE351

AP011532.PE351       Location/Qualifiers
FT   CDS_pept        355776..356147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Nucleotide binding protein, PINc domain
FT                   (IPR006596)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60423"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF1"
FT                   /protein_id="BAI60423.1"
FT                   /translation="MKVIVDTNGFMVQAQFGVDIMDELGRLGYDECIVPSAVLDELKML
FT                   EKKVRGKDKLAVAVATALARRCQGVDARGNADDVIVSLAKQLDADVFTNDAELRKRLRS
FT                   QGTKTVYMRSKHKLETDYM"
     atgaaggtca tcgtcgacac taacggcttc atggtgcagg cgcagttcgg tgtcgacata        60
     atggatgagc ttggccggct gggctacgat gaatgtatcg tgccttccgc cgtgctcgac       120
     gaattaaaaa tgctcgagaa gaaggtccgg ggcaaggata agctggccgt cgccgttgcc       180
     acggcgctgg cgaggcgctg tcagggcgtc gatgcccgcg ggaacgccga cgatgtcatc       240
     gtcagcctcg caaaacagct cgacgccgac gtgttcacca acgacgccga attgagaaaa       300
     cggctcagat cacagggcac gaagaccgtc tacatgcgct cgaagcacaa gctcgagacg       360
     gactacatgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page