(data stored in ACNUC10043 zone)

EMBL: AP011532.PE355

AP011532.PE355       Location/Qualifiers
FT   CDS_pept        complement(359536..359895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cupin 2, conserved barrel domain
FT                   (IPR013096)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60427"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF5"
FT                   /protein_id="BAI60427.1"
FT                   /translation="MMHNRSNISSYVTKDGSRIWELFHPGSSPVAGFSVAEARVDAGQE
FT                   TVAHVHHRSQEVYYILEGCGEMSLGGDALAVIQGDAILILPGKRHNIKNTGVGALRILC
FT                   ICSPPYAHEDTGTGL"
     atgatgcata atcgctctaa tatatcttcc tatgtgacga aggacgggtc caggatatgg        60
     gagctttttc accccggttc gtcccctgtc gccggcttca gcgtcgcgga ggcccgggtc       120
     gatgcgggac aggagacggt ggctcatgtg caccacaggt cgcaggaagt ctattatatt       180
     ctcgagggct gcggtgagat gagcctgggc ggcgatgcgt tagccgtcat ccagggcgat       240
     gccatactga tccttcccgg gaagcggcat aacataaaga atactggggt aggggcgctg       300
     cgaatactct gcatatgcag cccgccctac gctcacgagg acacgggaac gggcctgtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page