(data stored in ACNUC10043 zone)

EMBL: AP011532.PE356

AP011532.PE356       Location/Qualifiers
FT   CDS_pept        359968..360828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60428"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF6"
FT                   /protein_id="BAI60428.1"
FT                   /translation="MASKSNGPALVAGNSYYLPAMSNAGLFKGYVIDPGSVGYADVGRD
FT                   DIHTVLITHGHNDHFRRAREFRERGARVIASKEDALLVRNPEVNVRGLFSWARPPKEMI
FT                   TPYFQGDACEVDLYIEDWLDSSIRAIYLPGHTLGEYGFITEDGVLYSADSLYSKELWGK
FT                   YKLPYSIDPDLCRESIRKIKTLDFDYLVPGHGDPLSREDALKAADFHLSQLDFVDEVVL
FT                   ELLREPVSTESLVTKFCYELDLYKSLNNYWLTLVMLKGHLSSLNHQGRVAYKLENYCMF
FT                   WFKSK"
     atggcttcaa aaagtaatgg cccggccctc gtggccggca actcgtatta tctgcccgcg        60
     atgagcaacg cggggctttt caagggatac gtgatcgacc ccggctccgt cggatacgcc       120
     gacgtgggca gggatgatat ccataccgta ctgatcaccc acggccacaa cgaccacttc       180
     cgccgggcga gggagttcag ggagcgcggc gcccgggtca tcgcctcgaa ggaagacgcc       240
     ctgctcgtca ggaacccgga ggtcaatgtg cgcgggctgt tcagctgggc gcggccgccg       300
     aaggaaatga tcaccccgta cttccagggc gacgcctgcg aggtcgacct ctacatcgag       360
     gactggctgg actcgtccat ccgggctatt tatttgcccg gccacacgct gggcgagtac       420
     gggttcatca ccgaggacgg cgtcctgtac tcggccgact cgctatactc gaaggagctc       480
     tggggcaagt acaagctgcc ctacagcatc gacccggacc tgtgccgcga gtcgatcaga       540
     aagataaaga ccctggactt cgactacctg gtgccgggcc acggcgatcc tttgagcagg       600
     gaggatgcgc tcaaggccgc ggacttccac ctgagccagc tcgacttcgt ggacgaggtc       660
     gtcctcgagc ttctcaggga gcccgtatcg accgagagcc tggtcacgaa gttctgctac       720
     gagctcgacc tgtataagag cctgaataac tactggctga cgctggtgat gctgaagggc       780
     cacctgagca gcctcaacca ccagggcagg gtggcataca agctcgagaa ctactgcatg       840
     ttctggttta aatcaaagta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page