(data stored in ACNUC10043 zone)

EMBL: AP011532.PE357

AP011532.PE357       Location/Qualifiers
FT   CDS_pept        361193..362272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0357"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one PAS domain (IPR000014).; Contains one
FT                   PAS-associated, C-terminal domain (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains one PAC motif repeat (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60429"
FT                   /db_xref="GOA:D1YVF7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF7"
FT                   /protein_id="BAI60429.1"
FT                   /translation="MRESEKKYRTVADNTYDWSFWLDPNGDFIYTSPSCERITGYRPEE
FT                   FKKDPDLLSKILHPDDKEAFKKHVYEHEKKAGPGDLELRLVTKTGIIIWIHHMCQPVFD
FT                   EQKHFLGSIGSNRDITTRKSAELALQEAKRLAEMYVELMGHDINNKNQVGIGYLELVLN
FT                   EPGLSEDVKRSIEKALGALHDSSGIINNVEKLQRISSGKVKVEKIDLGQKLVDIRARYL
FT                   ESPGKAVTINYTPEKECFVWANELLTDIFSNIIENAIKHSRGPVTIDIKRGEMIRDGKY
FT                   YCKVTIDDNGPGIPDELKERLFARFQRGVTRAKGKGLGLYLVKSLVESYGGMVWVEDRV
FT                   RGDHTGGARFVVALPAVEK"
     ttgcgtgaga gcgagaaaaa gtatcgcaca gtcgctgaca atacctatga ttggtcgttc        60
     tggttggacc cgaacggtga tttcatatac acgtcgccgt cttgcgaaag gataaccggg       120
     tataggcccg aagagttcaa gaaagacccg gacttgctat caaaaatctt gcatcctgat       180
     gacaaggaag cctttaaaaa acacgtgtac gagcacgaaa aaaaagccgg acctggcgac       240
     cttgagttac gcttagtcac aaaaaccggt attattatat ggattcacca catgtgccag       300
     ccggtttttg atgagcagaa acatttcctt ggatcaatag gaagtaatcg cgatatcacg       360
     actcgtaaga gcgctgaatt agcattacaa gaggctaaaa ggttggctga aatgtacgtg       420
     gagctcatgg gccatgacat caataataag aaccaggtgg gtataggtta tcttgaactg       480
     gtgctcaatg agccgggcct cagcgaagac gtaaaacgat ccattgaaaa agcccttgga       540
     gcgcttcatg acagctcggg aatcatcaat aacgtagaaa agctccagcg cattagttcg       600
     ggtaaagtta aagtcgaaaa gatcgacctc gggcaaaaat tggtcgacat tcgggcccgc       660
     tacctggagt ctccaggcaa ggcagtcacc ataaactata ccccggagaa agagtgtttt       720
     gtatgggcaa acgagctttt gacggacata ttttcgaata tcatagagaa cgccattaag       780
     cattcccgtg gcccggtgac aatcgatatc aagcggggcg aaatgatacg ggacggtaaa       840
     tattattgta aggtcaccat agacgacaat gggcccggta taccggatga actaaaggag       900
     cgactgttcg cgcggttcca gcgaggggta actcgagcca agggtaaagg gctcggtcta       960
     tatcttgtta aatcccttgt cgaaagttat ggtggaatgg tgtgggttga ggaccgggta      1020
     cggggcgacc acacgggggg agccagattc gtggtcgcgt tgcctgcggt tgagaagtag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page