(data stored in ACNUC10043 zone)

EMBL: AP011532.PE358

AP011532.PE358       Location/Qualifiers
FT   CDS_pept        complement(362435..363310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0358"
FT                   /product="peptidase M48, Ste24p family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60430"
FT                   /db_xref="GOA:D1YVF8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF8"
FT                   /protein_id="BAI60430.1"
FT                   /translation="MKDIPGQRYITGMNASKKNGADEYYVSGERRQGITFYIILALILG
FT                   LVIILAAEAYRSLSPLGMETFWSFAYLAASLAVGATAGIILFNSFNSYRIIQAMLRNSL
FT                   KASPHAFPEIYDIVGLAAERLHVQAPDTYVSQSPAVNAYLVRLGLRKKVIIINTGLLRA
FT                   MDQDELLFILGHEISHAKYGRWRRIPGLGLPYVIAPQYNEYRCDRGGLVASRNIDASVR
FT                   ALLKLVTGKEFIDRVSVKDLANEKGEAPPSEAPSKVLQRLASHPMIGARIKELMKFHSS
FT                   PAYTAYQNIS"
     atgaaagata taccggggca gcgttatatc acagggatga acgcctcgaa gaaaaacggc        60
     gccgacgagt attacgtgag cggggagcgc aggcagggca tcacttttta cattatacta       120
     gccctgatac tggggctggt cattattctc gcggcggagg cttacaggag cctgtccccg       180
     ctgggcatgg agaccttctg gtctttcgcc tacctggcgg ccagcctggc agtaggggcg       240
     acggccggca tcattctatt taattctttt aacagctacc gcatcatcca ggccatgctc       300
     cgcaacagcc tcaaggcctc gccccatgcg ttcccggaga tatacgatat cgtagggctg       360
     gccgcggaga ggctccacgt gcaggcgccc gatacgtacg tctcccagag cccggcggtg       420
     aacgcttacc tggtgcgcct gggcctgaga aagaaggtca tcattatcaa taccgggctc       480
     cttcgggcga tggaccagga cgaattactg ttcatcctgg ggcatgagat atcacacgca       540
     aagtacggcc gatggaggcg catacccggg ctgggcctcc catacgtcat cgccccgcag       600
     tacaacgagt acaggtgcga ccggggaggg ctcgtcgcct cccggaacat cgacgcgtcc       660
     gtccgggccc tgctgaagct ggtcaccgga aaggagttca tcgaccgagt cagcgtgaaa       720
     gacctggcaa atgaaaaggg cgaggcgcct ccttcggagg cgccgtctaa ggtgctccag       780
     aggctggcat cgcacccgat gatcggcgca aggataaagg aattaatgaa gttccacagc       840
     tcgccggctt acaccgcgta ccagaatata agctag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page