(data stored in ACNUC10043 zone)

EMBL: AP011532.PE36

AP011532.PE36        Location/Qualifiers
FT   CDS_pept        27321..27503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60108"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI6"
FT                   /protein_id="BAI60108.1"
FT                   /translation="MRTAILFLVIVLLIAAPLPACEAAPGNIVHAADDGYGLGCPGCPG
FT                   CPDNPVRDPNAPACF"
     atgagaacgg ctatcctatt cctcgtgatc gtgctgctga tagcggcacc gctgccagcc        60
     tgtgaggccg cgccaggcaa catcgtccac gcggcggacg acgggtacgg gctgggctgc       120
     cccgggtgcc cgggatgccc cgacaatccg gtcagggacc cgaacgcgcc cgcgtgcttt       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page