(data stored in ACNUC10043 zone)

EMBL: AP011532.PE363

AP011532.PE363       Location/Qualifiers
FT   CDS_pept        366344..367450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60435"
FT                   /db_xref="GOA:D1YVG3"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR017675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG3"
FT                   /protein_id="BAI60435.1"
FT                   /translation="MEQLATAGRIIQPRPSSIVAALYTLRDLDTDVAILHGPPGCCFKH
FT                   SRLLEEDGMHVVTTAMCDSDYVFGGHDLLVNVLEKVIDRFHPRTVGIVGTCASMIIGEN
FT                   FHRAVEEADVEVPVIEVEIHAGYSDNTHGAIVTLEAANAVGLLSEAELERQKRMLLLAT
FT                   DIEKKFGAASKDYIEPSRGDLKYRAAERLLELMRQGKRGLSVLNAKKETAYMFADINLA
FT                   VSQAARAVGAPSPITIANLDPDVGLPRIRRYATTITAQLKENGVTIDHITGGLDEYPMS
FT                   GEKAARIITEKYSNYDYVVLSGVPHAVPYEAIRGMEIFSITNGPRQAEPLKAAGHGHVM
FT                   VEVDLHPKTLGVHGMVESELGETLRSML"
     atggaacaac tagcgaccgc cgggcgcatc atccagcccc gccccagctc tatcgtcgcc        60
     gcgctataca cgttgcgcga tctggacacg gatgtcgcca ttctccacgg ccctccgggg       120
     tgctgcttca agcattcccg gctcctggag gaggacggca tgcacgtcgt caccacggcg       180
     atgtgcgact cggactacgt cttcggcggc cacgacctgc tcgtgaacgt cctggaaaag       240
     gtcatcgacc ggttccaccc gaggaccgtg ggcatcgtgg ggacctgcgc gagcatgatc       300
     atcggcgaga actttcaccg tgccgtcgaa gaggccgacg tggaagtgcc ggtcatcgag       360
     gtggagatcc acgccgggta tagcgataac actcatgggg cgatcgtgac gctggaggcc       420
     gccaatgcgg tcggcctgct gagcgaggca gaactggaaa ggcaaaagag aatgcttcta       480
     ctggctacgg atatagagaa aaagttcggc gcagccagca aggactatat cgagccttcc       540
     cgcggggacc tgaaataccg ggcagccgaa cgattacttg aattaatgag gcagggcaag       600
     aggggcctgt cggtcctcaa cgcaaagaag gagacggcct acatgttcgc cgacatcaac       660
     ctggccgtga gccaggccgc ccgcgccgta ggcgcacctt cgccgatcac catcgccaac       720
     ctggaccctg acgtagggct cccgaggata cgcaggtacg ccacaacgat caccgcccag       780
     cttaaagaga atggcgtcac aatagaccac atcaccgggg ggctcgacga atacccaatg       840
     agcggagaaa aggccgcccg catcataacg gaaaaatatt caaactatga ttacgtcgtg       900
     ctctcgggcg taccccatgc cgtaccatac gaagccatcc ggggcatgga gatattctcg       960
     atcacgaacg ggccgagaca ggcggagccc ctgaaggcgg ccgggcacgg ccacgtcatg      1020
     gtggaagtgg acctgcaccc gaagacgctc ggcgtccacg gcatggtcga gtcggagctc      1080
     ggggagacgc tgaggagcat gttatga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page