(data stored in ACNUC10043 zone)

EMBL: AP011532.PE367

AP011532.PE367       Location/Qualifiers
FT   CDS_pept        374301..374936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60439"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG7"
FT                   /protein_id="BAI60439.1"
FT                   /translation="MIPMDFEKYIGKEKPLLSRLDRDRASLNAYERRGNAGTLDIAEDE
FT                   LKLLDTLKQVKEHIAAAEAASKALDERAQRLKELEESVNRKGAQTQKRIEEWESSFDDK
FT                   YNVLLKRVEDEVGALELRNKELVAFMKAQEDIFNARSAELSSRADASEAGIKQASDNAY
FT                   QEMSDILVSMKKAQKEFETSISGKLDEDKQTIDRIKYMLSTMSDIIKS"
     gtgatcccca tggacttcga gaagtacata ggcaaggaga agccgctctt atcccggctg        60
     gaccgggaca gggcgtccct gaacgcgtac gagcgcaggg gcaacgcggg aacgctcgac       120
     atcgccgagg acgagctcaa gctgctcgac acgctgaagc aggtgaagga gcacatcgcg       180
     gccgccgagg cggcgtcgaa ggccctggac gagcgcgccc aaagattaaa agagctcgag       240
     gagtccgtca acaggaaggg cgcccagacc cagaagcgca tcgaggaatg ggaaagctcg       300
     ttcgacgata agtacaacgt gctgctgaag cgggtcgagg acgaggtcgg ggcgctggag       360
     cttagaaata aggagctcgt ggcgttcatg aaggcccagg aggacatctt caacgcccgc       420
     agcgccgagc tcagcagcag ggcggacgcg tccgaggcgg gcataaagca ggccagcgac       480
     aacgcctacc aggagatgag cgacatcctc gtgtccatga agaaggcaca gaaggagttc       540
     gagacctcca taagcggcaa gctcgacgag gataagcaga ccatcgaccg catcaagtac       600
     atgctgtcca cgatgagtga cattattaaa tcctag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page