(data stored in ACNUC10043 zone)

EMBL: AP011532.PE373

AP011532.PE373       Location/Qualifiers
FT   CDS_pept        complement(379466..379795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60445"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH3"
FT                   /protein_id="BAI60445.1"
FT                   /translation="MPEFYKVSFDEDELGAIRRGCDIRSGHEDRMLDEAAGGSLEGVVM
FT                   QESRADDMLLIKGTVDIFKPGQTILITMEDLRMIRSCLDDDDSPGAKSAVKKIDASLAS
FT                   GAERR"
     atgcccgaat tttataaggt ctcgttcgac gaggacgagc tgggggcgat ccgccgcggc        60
     tgcgatatcc ggtccggaca cgaggaccgc atgctggacg aggcggccgg aggctccctg       120
     gagggcgtgg tgatgcagga gagccgggcc gacgacatgc ttctcattaa aggcaccgtc       180
     gacatattca agccagggca gaccatcctc atcacgatgg aggacctgcg gatgataaga       240
     agctgccttg acgatgatga ctccccgggg gcgaagagcg ccgtaaaaaa gatcgacgcc       300
     tctctggcta gtggggcaga aaggcgatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page