(data stored in ACNUC10043 zone)

EMBL: AP011532.PE377

AP011532.PE377       Location/Qualifiers
FT   CDS_pept        382089..382874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0377"
FT                   /product="peptidase S54, rhomboid family protein"
FT                   /note="Contains one Zinc finger, AN1-type domain
FT                   (IPR000058)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60449"
FT                   /db_xref="GOA:D1YVH7"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH7"
FT                   /protein_id="BAI60449.1"
FT                   /translation="MPENRCDVCSAFELLPFKCKYCGGTFCGAHRLPESHNCPGLRMLK
FT                   QRPAADSRATVKRRSALRLPAAKLPYSGYYAYALIAITVIVYVLQVLFPGITDALILSS
FT                   SNLLSHPWGILTSIFLHSSLMHLFFNMLALFFFGPLLERRIGSGRFLGLYFGTGIIAGL
FT                   AQILAFPGSAVLGASGAIFGVLGTLTVLTPDLVVYLYFVPLKMVYVTILFAVLDLFPVL
FT                   TGTSDGVAHIAHLAGLAIGLAAGFWYRQKSKIRSVRWQV"
     atgccagaga accgatgtga cgtatgcagc gcgtttgagc tactgccgtt caagtgtaaa        60
     tattgcggcg gcacattctg cggagcccac cgcctccccg agagccataa ctgcccgggg       120
     ctgcggatgc tgaagcagag gccggctgcg gactccaggg cgaccgtgaa gcgcaggagc       180
     gctctcaggc tgccggccgc gaagctgcct tactcgggct attacgcgta cgccctcatc       240
     gctatcaccg tcatcgtgta cgtccttcag gtgctcttcc ccgggatcac ggacgcgcta       300
     atactcagct cgtcaaacct gctgtcgcac ccatggggta tcctgacgag cattttctta       360
     cacagcagcc tcatgcatct cttcttcaac atgctcgcgc tcttcttctt cggcccgctc       420
     ctggagcgcc gcatcggcag cgggcggttc ctgggcctat acttcggcac cggcatcatc       480
     gccggcctgg cccagatact cgcgttcccg ggctccgccg tccttggggc gagcggcgcc       540
     atcttcggcg tgctcggcac ccttaccgtt cttacgcccg accttgtcgt ctatctctac       600
     ttcgtgccgc tcaagatggt ctacgtcacc atcctgttcg cggtccttga cctgttcccc       660
     gtgctcaccg gcacttcgga cggcgtggcg cacatcgcgc acctggcggg gctggccatc       720
     ggcctggccg cgggcttctg gtaccgccag aagagcaaga tacggagcgt ccggtggcag       780
     gtctag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page